NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087903

Metagenome / Metatranscriptome Family F087903

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087903
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 58 residues
Representative Sequence MKTNIITEEEQIEEILTEANAYNLRQEVITTASIFMKDDPELDKVAAYQMAYMEWIK
Number of Associated Samples 90
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.45 %
% of genes near scaffold ends (potentially truncated) 23.64 %
% of genes from short scaffolds (< 2000 bps) 72.73 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.636 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(33.636 % of family members)
Environment Ontology (ENVO) Unclassified
(74.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.182 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 47.06%    β-sheet: 0.00%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.73.1.1: Retrovirus capsid protein, N-terminal core domaind1em9a_1em90.67334
c.37.1.20: Extended AAA-ATPase domaind1lv7a_1lv70.66799
e.22.1.2: Iron-containing alcohol dehydrogenased1vlja11vlj0.66086
c.37.1.20: Extended AAA-ATPase domaind1fnna21fnn0.65191
e.22.1.2: Iron-containing alcohol dehydrogenased1jq5a_1jq50.65106


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00856SET 17.27
PF04024PspC 5.45
PF01165Ribosomal_S21 3.64
PF00535Glycos_transf_2 2.73
PF00149Metallophos 1.82
PF05159Capsule_synth 1.82
PF12850Metallophos_2 0.91
PF00313CSD 0.91
PF01258zf-dskA_traR 0.91
PF08406CbbQ_C 0.91
PF07592DDE_Tnp_ISAZ013 0.91
PF00160Pro_isomerase 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 3.64
COG3562Capsule polysaccharide modification protein KpsSCell wall/membrane/envelope biogenesis [M] 1.82
COG3563Capsule polysaccharide export protein KpsC/LpsZCell wall/membrane/envelope biogenesis [M] 1.82
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.91
COG0714MoxR-like ATPaseGeneral function prediction only [R] 0.91
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.18 %
UnclassifiedrootN/A11.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573027|GS312G0146KB_1113212356106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium948Open in IMG/M
3300000117|DelMOWin2010_c10001378Not Available15650Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10036080All Organisms → Viruses → Predicted Viral1960Open in IMG/M
3300001450|JGI24006J15134_10005492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6603Open in IMG/M
3300001460|JGI24003J15210_10014598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3098Open in IMG/M
3300001460|JGI24003J15210_10026968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2127Open in IMG/M
3300001460|JGI24003J15210_10033975All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1835Open in IMG/M
3300001460|JGI24003J15210_10039935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1638Open in IMG/M
3300001460|JGI24003J15210_10102888Not Available813Open in IMG/M
3300001472|JGI24004J15324_10033477All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1645Open in IMG/M
3300003543|FS898DNA_10484309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium740Open in IMG/M
3300004097|Ga0055584_100177038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2159Open in IMG/M
3300004448|Ga0065861_1006059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3511Open in IMG/M
3300004448|Ga0065861_1029768All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1458Open in IMG/M
3300005404|Ga0066856_10225488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium813Open in IMG/M
3300005404|Ga0066856_10293582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium701Open in IMG/M
3300005427|Ga0066851_10058865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1292Open in IMG/M
3300006737|Ga0098037_1234662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300006737|Ga0098037_1249906Not Available569Open in IMG/M
3300006750|Ga0098058_1160275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300006750|Ga0098058_1196006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium526Open in IMG/M
3300006803|Ga0075467_10022754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4025Open in IMG/M
3300006920|Ga0070748_1007754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4739Open in IMG/M
3300006924|Ga0098051_1106622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium750Open in IMG/M
3300007231|Ga0075469_10037969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1505Open in IMG/M
3300008470|Ga0115371_11217394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300009080|Ga0102815_10272184All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium935Open in IMG/M
3300009428|Ga0114915_1006840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4529Open in IMG/M
3300009428|Ga0114915_1154854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300009436|Ga0115008_10668098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium752Open in IMG/M
3300009447|Ga0115560_1060103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1649Open in IMG/M
3300009593|Ga0115011_10679722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium839Open in IMG/M
3300009785|Ga0115001_10052138All Organisms → Viruses → Predicted Viral2694Open in IMG/M
3300009790|Ga0115012_11329750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300011253|Ga0151671_1123207Not Available685Open in IMG/M
3300012413|Ga0138258_1032359Not Available919Open in IMG/M
3300012920|Ga0160423_10978190Not Available567Open in IMG/M
3300013098|Ga0164320_10009121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3734Open in IMG/M
3300013101|Ga0164313_11705077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium506Open in IMG/M
3300017706|Ga0181377_1005821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3258Open in IMG/M
3300017708|Ga0181369_1005165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3486Open in IMG/M
3300017709|Ga0181387_1000289All Organisms → cellular organisms → Bacteria11889Open in IMG/M
3300017709|Ga0181387_1005665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2456Open in IMG/M
3300017709|Ga0181387_1010077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1830Open in IMG/M
3300017713|Ga0181391_1021617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1599Open in IMG/M
3300017717|Ga0181404_1075395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium836Open in IMG/M
3300017720|Ga0181383_1069838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium943Open in IMG/M
3300017728|Ga0181419_1174267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300017729|Ga0181396_1050942All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium826Open in IMG/M
3300017730|Ga0181417_1070750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium848Open in IMG/M
3300017740|Ga0181418_1087325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium759Open in IMG/M
3300017743|Ga0181402_1017123All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2107Open in IMG/M
3300017751|Ga0187219_1213033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300017753|Ga0181407_1009224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2838Open in IMG/M
3300017757|Ga0181420_1020603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2196Open in IMG/M
3300017758|Ga0181409_1141200Not Available707Open in IMG/M
3300017759|Ga0181414_1055283All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1060Open in IMG/M
3300017763|Ga0181410_1017543All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2391Open in IMG/M
3300017764|Ga0181385_1092518Not Available927Open in IMG/M
3300017765|Ga0181413_1218018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300017768|Ga0187220_1078712All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium994Open in IMG/M
3300017771|Ga0181425_1041691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1503Open in IMG/M
3300017773|Ga0181386_1079520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1033Open in IMG/M
3300017950|Ga0181607_10347575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium821Open in IMG/M
3300019009|Ga0192880_10093841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium765Open in IMG/M
3300020165|Ga0206125_10312900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300020173|Ga0181602_10370314All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300020317|Ga0211688_1005594All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3158Open in IMG/M
3300020347|Ga0211504_1013307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2379Open in IMG/M
3300020378|Ga0211527_10063218All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300020379|Ga0211652_10011661All Organisms → Viruses → Predicted Viral2648Open in IMG/M
3300020382|Ga0211686_10075372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1371Open in IMG/M
3300020404|Ga0211659_10246141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium794Open in IMG/M
3300020436|Ga0211708_10462873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300020469|Ga0211577_10261243Not Available1111Open in IMG/M
3300020469|Ga0211577_10808148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300020475|Ga0211541_10372120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium698Open in IMG/M
3300021185|Ga0206682_10166273All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1028Open in IMG/M
3300021364|Ga0213859_10404521All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium604Open in IMG/M
3300021368|Ga0213860_10121779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1146Open in IMG/M
3300021375|Ga0213869_10005390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8127Open in IMG/M
3300021375|Ga0213869_10010324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5610Open in IMG/M
3300021375|Ga0213869_10398702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300021505|Ga0190327_1064489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
(restricted) 3300022938|Ga0233409_10272798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
(restricted) 3300024529|Ga0255044_10480872All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300025048|Ga0207905_1002881All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3477Open in IMG/M
3300025048|Ga0207905_1003474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3106Open in IMG/M
3300025048|Ga0207905_1007479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1982Open in IMG/M
3300025071|Ga0207896_1024955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1026Open in IMG/M
3300025112|Ga0209349_1002608Not Available8475Open in IMG/M
3300025120|Ga0209535_1045204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1928Open in IMG/M
3300025120|Ga0209535_1084937All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1185Open in IMG/M
3300025120|Ga0209535_1149259Not Available740Open in IMG/M
3300025127|Ga0209348_1009661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3906Open in IMG/M
3300025127|Ga0209348_1161786Not Available651Open in IMG/M
3300025127|Ga0209348_1162127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300025151|Ga0209645_1032510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1913Open in IMG/M
3300025276|Ga0208814_1039127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1447Open in IMG/M
3300025759|Ga0208899_1195445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium648Open in IMG/M
3300027752|Ga0209192_10022729All Organisms → Viruses → Predicted Viral3097Open in IMG/M
3300027845|Ga0209271_10044990Not Available1833Open in IMG/M
3300027849|Ga0209712_10184320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1191Open in IMG/M
3300028130|Ga0228619_1025230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1850Open in IMG/M
3300029448|Ga0183755_1014545All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2866Open in IMG/M
3300029787|Ga0183757_1017287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1813Open in IMG/M
3300031519|Ga0307488_10679690All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300031569|Ga0307489_11297271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300031621|Ga0302114_10059966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1846Open in IMG/M
3300031700|Ga0302130_1155435All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium713Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.64%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater20.91%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.82%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.45%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.64%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean2.73%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.82%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.82%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.82%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.82%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.91%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.91%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.91%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.91%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.91%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.91%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.91%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.91%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.91%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.91%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.91%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.91%
Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment0.91%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.91%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.91%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573027Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmaxEnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300003543Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005404Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205EnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020317Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020378Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021505Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-04-0-1_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GS312G0146KB_003672202189573027Marine EstuarineMINRGREWDWMEEEVQVEEILSEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK
DelMOWin2010_1000137823300000117MarineMINTGREWDFMEDEVQIEEILTEANAYNLKQEVITTAEVFMKDDPELNKVIAYEMAYMEWIK*
SA_S1_NOR08_45mDRAFT_1003608033300000128MarineMINSKREWVYDIEQILIEATAYNLRQEVINTAESFIKEDPDLNKANAYAMAYMEWIK*
JGI24006J15134_1000549273300001450MarineMTDTVEIEIEEILTEANAYNLRDEVKTTAXMFIMXDPQLDKVSAYNMAYLEWIK*
JGI24003J15210_1001459863300001460MarineMTDTVEIEIEEILTEANAYNLRDEVKTTAEMFIMDDPQLDKVSAYNMAYLEWIK*
JGI24003J15210_1002696833300001460MarineMINRGREWDFVEDQAQIEEILIEANAYNLKAEVNTTAAMFMEDDPDLSKVVAYQMAYMEWIK*
JGI24003J15210_1003397523300001460MarineMKDTITEEEQIEQILEEANAYNLRQEVITTAETFIKDDPELDKIVAYEMGYMEWVK*
JGI24003J15210_1003993533300001460MarineMKDTITEEEQIEEVLTEANAYGLRQEVITTAAIFMKDDPELDKVSAYNMAYLEWIK*
JGI24003J15210_1010288823300001460MarineMKDIITEQEQIEEIXXEANAXXLRQEVITTAAIFMKDDPELDEVAAYHMAYMEWVK*
JGI24004J15324_1003347743300001472MarineMKDIITEQEQIEEILTEANAYNLRQEVITTAAIFMKDDPELDEVAAYHMAYMEWVK*
FS898DNA_1048430923300003543Diffuse Hydrothermal Flow Volcanic VentMINTGREWDFMEDEVQIEEILTEANAYNLKQEVITTAKVFMKDDPELNKVVAYEMAYIEWIK*
Ga0055584_10017703813300004097Pelagic MarineMINSGREWDFIEENIQIEEILTEANAYNLKQEVITTAAIFMKDDPELDKVSAYNMAYLEWVK*
Ga0065861_100605993300004448MarineMKDTITEEEQIEEILTEANAYSLRQEVKLTADMFVKDDPDLNKILAYEMAYMEWIK*
Ga0065861_102976853300004448MarineMRSVITEEQQIEEILAEANAYSLKSEVTTTAEMFIKDDPDLRRVIAYEMAYIEWIK*
Ga0066856_1022548813300005404MarineKIMSTKDWDNKSDEEQIEQILMEANAYNLRNEVKTTAEMFIKDDPDLNKACAYDMAYMQWINPVEKN*
Ga0066856_1029358223300005404MarineMNKEIETKEWDNKSDEEQIEEILTEANAYNLRQEVITTAEVFMKDDPDLNKTLAYEMAYMEWIK*
Ga0066851_1005886523300005427MarineMEIMETKEWDSKSDEEQIEEILTEANAYNLRQEVKVTAETFIKDDPDLNKALAYEMAYKEWIK*
Ga0098037_123466223300006737MarineMKTNIISEEEQIEEILTEANSYNLRQEVITTASMFMQDDPELDKVAAYQMAYMEWIK*
Ga0098037_124990623300006737MarineMKDTITEEEQIEQILEEANAYNLRQEVITTSEMFLIDDPELDRVVAYEMGFME
Ga0098058_116027523300006750MarineMINSGKEWDFMEEEVQIEEILTEANAYNLRQEVITTAEVFMKDDPDLNKAVAYEMAYMEWVK*
Ga0098058_119600623300006750MarineMINRGREWDWMEEEVQVEEILAEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK*
Ga0075467_1002275443300006803AqueousMINSGREWDFIEENIQIEEILTEANAYNLRQEVMTTAAIFMKDDPELDKVSAYNMAYMEWVK*
Ga0070748_100775453300006920AqueousMINSGREWDFIEENIQIEEILTEANAYNLKQEVMTTAAIFMKDDPELDKVSAYNMAYMEWVK*
Ga0098051_110662233300006924MarineMINIGREWDWMEEEVQVEEILAEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK*
Ga0075469_1003796953300007231AqueousMINSGKEWDFMEDEVQIEEILAEANAYNLRQEVITTAEVFMKDDPNLNKVLAYEMAYMEWVK*
Ga0115371_1121739413300008470SedimentLEEDIIQIEEILTEANAYNLRNEVMITAHSFIKDDPDLDKVAAFQMAYIEWVKN*
Ga0102815_1027218423300009080EstuarineMINRGREWDWMEEEVQVEEILTEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK*
Ga0114915_100684093300009428Deep OceanMINSEREWDYMDEAVQIEEILTEANAYNLKQEVMTTAAIFMKDDPELDKVSAYNMAYLEWVK*
Ga0114915_115485413300009428Deep OceanTKRDTEIQIEEILTEANAYSLRAEVILTANTFMKEDPDLDKILAYEMAYMEWIK*
Ga0115008_1066809833300009436MarineMINSGREWDFIEENIQIEEILTEANAYNLKQEVITTAAIFMKDDPELDKVSAYNMAYMEWVK*
Ga0115560_106010343300009447Pelagic MarineMINSGREWDFIEENIQIEEILTEANAYNLKQEVITTAAIFMKDDPELDKVSAYN
Ga0115011_1067972213300009593MarineMKKEIEKTEEEQIEEILQEANAYNLRQEVKTTAEMFIMDDPALNRALAYEMAYME
Ga0115001_1005213833300009785MarineMINREREWVYDIEQILIEATAYNLRQEVINTAESFIKEDPDLNKANAYAMAYMEWIK*
Ga0115012_1132975033300009790MarineDNKSDEEQIEQILMEANAYNLRNEVKTTAEMFIKDDPDLNKACAYDMAYMQWINPVEKN*
Ga0151671_112320713300011253MarineMKDTITEEEQIEEILTEANAYSLRQEVITTAAMFMKDDPGLEQIVAYQMAYMEWVK*
Ga0138258_103235923300012413Polar MarineMKELEQNIIDEMQIEELLTEANAYGLRSEVVTTAKAFIKDDPDLSKVVAYEMAYMDWVK*
Ga0160423_1097819033300012920Surface SeawaterMKKELEKTDGEQIEEILQEANAYNLKQEVTTTAEMFIKDDPALNRVLAYEMAYMEWIK*
Ga0164320_10009121133300013098Marine SedimentMINSGREWDWMEEEEQVEEILTEANAYNLRAEVKTTAEMFIKDDPELSKTAAYQMAYIEWIK*
Ga0164313_1170507723300013101Marine SedimentMNKEIETKEWDNKSDEEQIEEILIEANAYNLRQEVITTAEVFMKDDPELNKTLAYEMAYMEWIK*
Ga0181377_100582183300017706MarineMINSEREWDWMDDKDISEEVQIEEILTEANGYNLRQEVLTTAKIFIKDDPELSRVAAHQMAYMEWIR
Ga0181369_100516543300017708MarineMINSGKEWDFMEEEVQIEEILTEANAYNLRQEVITTAEVFMKDDPDLNKAVAYEMAYMEWVK
Ga0181387_100028943300017709SeawaterMKTNIITEEEQIEEILTEANAYNLRQEVITTASIFMKDDPELDKVAAYQMAYMEWIK
Ga0181387_100566573300017709SeawaterMINTGREWDFMEDEVQIEEILTEANAYNLKQEVITTAEVFMKDDPELNKVVAYEMAYMEWIK
Ga0181387_101007753300017709SeawaterMEQIQIEEETIEEILTEANAYNLRQEVKTTAEMFIKDDPDLNRVAAYNMAYIEWIK
Ga0181391_102161733300017713SeawaterMINTGREWDFMEDEVQVEEILTEANAYNLKQEVITTAEVFMKDDPELNKVVAYEMAYMEWIK
Ga0181404_107539513300017717SeawaterNSGREWDWMEEEEQVEEILTEANAYNLRAEVKTTAEMFIKDDPELSKTAAYQMAYIEWIK
Ga0181383_106983823300017720SeawaterMNKEIEKTEEEQIEEILQEANAYNLRQEVKTTAEMFIMDDPALNRALAYEMAYMEWVK
Ga0181419_117426713300017728SeawaterEQIEQILEEANAYNLRQEVITTAETFIKDDPELDKIVAYEMGYMEWVK
Ga0181396_105094233300017729SeawaterMEEEVQVEEILTEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK
Ga0181417_107075013300017730SeawaterKKLIKLKIMSTKDWDNKSDEEQIEQILMEANAYNLRNEVKTTAEMFIKDDPDLNKACAYDMAYMQWINPVEKN
Ga0181418_108732523300017740SeawaterMNKEIETKEWDNKSDEEQIEEILTEANAYNLRQEVITTAEVFIKDDPDLNKTLAYEMAYMEWIK
Ga0181402_101712343300017743SeawaterMINSGREWDWMEEEEQVEEILTEANAYNLRAEVKTTAEMFIKDDPELSKTAAIRWLT
Ga0187219_121303323300017751SeawaterMEQIQTEEETIEEILTEANAYNLRQEVKTTAEMFIKDDPDLNRVAAYNMAYIEWIK
Ga0181407_100922423300017753SeawaterMINRGREWDWMEEEVQVEEILSEANAYNLKAKVNITAMKFMKEDPELSKVAAYQMAYIEWVK
Ga0181420_102060323300017757SeawaterMKDTITEEEQIEEILTEANAYNLRQEVITTAAMFMKDDPGVDHVVAYQMAYMEWVK
Ga0181409_114120013300017758SeawaterMKDTITEEEQIEEILTEANAYSLRQEVITTAAMFMKDDPGLEQIVAYQMAYMEWVK
Ga0181414_105528353300017759SeawaterEEQIEQILMEANAYNLRNEVKTTAEMFIKDDPDLNKACAYDMAYMQWINPVEKN
Ga0181410_101754343300017763SeawaterMKDTITEEEQIEEILTEANAYNLRQEVITTAAMFMKDAPGLDHVVAYQMAYMEWVK
Ga0181385_109251823300017764SeawaterMKDIITEEEQIEQILEEANAHNLRQEVITTSEMFLIDDPELDRVVAYEMGFMEWVK
Ga0181413_121801813300017765SeawaterNIITEEEQIEEILTEANAYNLRQEVITTASIFMKDDPELDKVAAYQMAYMEWIK
Ga0187220_107871243300017768SeawaterSDEEQIEQILMEANAYNLRNEVKTTAEMFIKDDPALNKVLAYEMAYMEWIK
Ga0181425_104169113300017771SeawaterIQIEEETIEEILTEANAYNLRQEVKTTAEMFIKDDPDLNRVAAYNMAYIEWIK
Ga0181386_107952023300017773SeawaterMKTNIITEEEKIEEILTEANAYNLRQEVITTASIFMKDDPELDKVAAYQMAYMEWIK
Ga0181607_1034757533300017950Salt MarshMINSGREWDWMEEEDQVEEILTEANAYNLRAEVKTTAEMFIKDDPELSKTAAYQMAYIEWIK
Ga0192880_1009384143300019009MarineEMKTNIITEEEQIEEILTEANSYNLRQEVITTASMFMQDDTELDKVAAYQMAYMEWIK
Ga0206125_1031290023300020165SeawaterMINSGREWDFIEENIQIEEILTEANAYNLKQEVITTAAIFMKDDPELDKVSAYNMAYLEWVK
Ga0181602_1037031413300020173Salt MarshMINSGREWDWMEEEEQVEEILTEANAYNLRAEVKTTAEMFIKDDPELSKTAAYQMAYIEWIK
Ga0211688_100559453300020317MarineMINSEREWDFMDEGVQIEEILTEANAYNLKQEVITTAAIFMKDDPELDKVSAYNMAYLEWVK
Ga0211504_101330743300020347MarineMINSGKEWDFMEDEVRIEEILIEANAYNLRQEVITTAEVFMKDDPDLNKAVAYEMAYMEWVK
Ga0211527_1006321853300020378MarineMRRMSWREEQIEEILQEANAYNLRQEVKTTAEMFIKDDPALNRALAYEMAYMEWVK
Ga0211652_1001166113300020379MarineMGQIQTEEEIIEEILTEANAYNLRQEVKTTAEMFIKDDPDLNHVAAYNMAYIEWIK
Ga0211686_1007537263300020382MarineEDIIQIEEILTEANAYNLRSEVMITAQSFIKDDPDLDKVSAFQMAYIEWIKN
Ga0211659_1024614133300020404MarineMKTNIISEEEQIEEILTEANSYNLRQEVITTASMFMQDDPELDKVAAYQMAYMEWIK
Ga0211708_1046287333300020436MarineMNKELEKTEEEQIEEILQEANAYNLRQEVKTTAEMFIKDDPALNKILAYEMAYMEWVK
Ga0211577_1026124313300020469MarineMKDTITEEEQIEEILTEANAYNLRQEVITTAAMFMKDDPGLDHVVAYQMAYMEWVK
Ga0211577_1080814833300020469MarineYKHGWEIEAEQIELILTEASAHNLRNEVKTTAEMFIKDDPQLERGTAYEMAYMQWIKN
Ga0211541_1037212033300020475MarineYKHGWEIQAEQIELILTEANAHNLRNEVKTTAEMFIKDDPELEPGIAYEMAYMQWIKN
Ga0206682_1016627323300021185SeawaterMINRGREWDWMEEEVQVEEILTEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK
Ga0213859_1040452123300021364SeawaterMKTKEWDSKSDEEQIEEILTEANAYNLRQEVKVTAETFIKDDPDLNKALAYEMAYMEWIK
Ga0213860_1012177923300021368SeawaterMKTKEWDSKSDEEQIEEILTEANAYNLRQEVKLTAEMFIKDDPDLNKALAYEMAYLEWIK
Ga0213869_1000539043300021375SeawaterMINSGREWDFIEENIQIEEILTEANAYNLKQEVMTTAAIFMKDDPELDKVSAYNMAYMEWVK
Ga0213869_1001032463300021375SeawaterMINTGREWDFMEDEVQIEEILTEANAYNLKQEVITTAEVFMKDDPELNKVIAYEMAYMEWIK
Ga0213869_1039870223300021375SeawaterMINSGKEWDFMEDEVQIEEILAEANAYNLRQEVITTAEVFMKDDPNLNKVLAYEMAYMEWVK
Ga0190327_106448933300021505Hydrothermal Vent SedimentKEWDNKSEEEQIEEILTEANAYNLRQEVKLTAEMFIKDDPDLNKALAYEMAYIEWIK
(restricted) Ga0233409_1027279813300022938SeawaterMINRGREWDWMEEEVQVEEILTEANAYNLKAEVNITAMKFMKEDPELSKVAA
(restricted) Ga0255044_1048087233300024529SeawaterEWDWMEEEVQVEEILTEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK
Ga0207905_100288173300025048MarineMTDTVEIEIEEILTEANAYNLRDEVKTTAEMFIMDDPQLDKVSAYNMAYLEWIK
Ga0207905_1003474113300025048MarineMINTGREWDFMEDEVQIEEILTEANAYNLKQEVITTAKVFMKDDPELNKVVAYEMAYIEWIK
Ga0207905_100747933300025048MarineMKDIITEQEQIEEILTEANAYNLRQEVITTAAIFMKDDPELDEVAAYHMAYMEWVK
Ga0207896_102495533300025071MarineMKDTITEEEQIEEVLTEANAYGLRQEVITTAAIFMKDDPELDKVSAYNMAYLEWIK
Ga0209349_1002608163300025112MarineMETKEWDSKSDEEQIEEILTEANAYNLRQEVKVTAETFIKDDPDLNKALAYEMAYKEWIK
Ga0209535_104520433300025120MarineMKDTITEEEQIEQILEEANAYNLRQEVITTAETFIKDDPELDKIVAYEMGYMEWVK
Ga0209535_108493753300025120MarineMKDTITEEEQIEEILTEANAYNLRQEVKLTADIFVKDDPDLNKILAYEMAYMEWIK
Ga0209535_114925923300025120MarineMKDIITEQEQIEEILAEANAYSLRQEVITTAAIFMKDDPELDEVAAYHMAYMEWVK
Ga0209348_100966163300025127MarineMNKEIEKTEEEQIEEILQEANAYNLRQEVKTTAEMFIKDDPALNRALAYEMAYMEWVK
Ga0209348_116178623300025127MarineMEETNYDNKTEQEQIEEILMEANAYNLRKEVKLAAEMFIKDDPDLNKALAYEMALLQWTK
Ga0209348_116212713300025127MarineMNKEIETKEWDNKSDEEQIEEILTEANAYNLRQEVITTAEVFMKDDPDLNKTLAYEMAYMEWIK
Ga0209645_103251043300025151MarineMKTKEWDNKSEEEQIEEILTEANAYNLRQEVKLTAEMFIKDDPDLNKALAYEMAYIEWIK
Ga0208814_103912753300025276Deep OceanMINSEREWDYMDEAVQIEEILTEANAYNLKQEVMTTAAIFMKDDPELDKVSAYNMAYLEWVK
Ga0208899_119544523300025759AqueousMKTKEWDNKSDEEQIEEILTEANAYNLRQEVKLTAEMFIKDDPDLNKALAYEMAYLEWIK
Ga0209192_1002272963300027752MarineMINSKREWVYDIEQILIEATAYNLRQEVINTAESFIKEDPDLNKANAYAMAYMEWIK
Ga0209271_1004499013300027845Marine SedimentMKDTITEEEQIEEILTEANAYSLRQEVKLTADMFVKDDPDLNKILAYEMAYMEWIK
Ga0209712_1018432023300027849MarineMIVPHDDDFMDDAIQIEEILTEANAYSLREEVKLTANTFIQEDPDLDKVLAYQMAYIDWI
Ga0228619_102523013300028130SeawaterEEVQVEEILTEANAYNLKAEVNITAMKFMKEDPELSKVAAYQMAYIEWVK
Ga0183755_101454563300029448MarineMKDTITEEEQIEQILEEANAYNLRQEVITTSEMFLIDDPELDRVVAYEMGFMEWVK
Ga0183757_101728723300029787MarineMKKEIEKTEEEQIEEILQEANAYNLRQEVKTTAEMFIMDDPALNRALAYEMAYMEWVK
Ga0307488_1067969013300031519Sackhole BrineIQIEEILTEANAYSLRAEVILTANTFIKEDPDLDKVLAYEMAYMDWIK
Ga0307489_1129727133300031569Sackhole BrineRDVQIEEILTEANAYSLREEVKLTANTFIQKDPDLDKVLAHEMAYLEWIK
Ga0302114_1005996623300031621MarineMINGEREWVYDIEQILIEATAYNLRQEVINTAESFIKEDPDLNKANAYAMAYMEWIK
Ga0302130_115543513300031700MarineMINGEREWVYDIEQILIEATAYNLRQEVINTAESFIKEDPDLNKANAYAMAFMEWIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.