Basic Information | |
---|---|
Family ID | F087819 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 44 residues |
Representative Sequence | VMAMAAHGRAVPGALILQNTLYTVIYCTIVLTAAAAVFSRRNLK |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.92 % |
% of genes near scaffold ends (potentially truncated) | 96.36 % |
% of genes from short scaffolds (< 2000 bps) | 85.45 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.182 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.455 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF01433 | Peptidase_M1 | 10.91 |
PF13485 | Peptidase_MA_2 | 1.82 |
PF12679 | ABC2_membrane_2 | 1.82 |
PF02687 | FtsX | 0.91 |
PF13414 | TPR_11 | 0.91 |
PF13720 | Acetyltransf_11 | 0.91 |
PF04461 | DUF520 | 0.91 |
PF13432 | TPR_16 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 10.91 |
COG1666 | Cyclic di-GMP-binding protein YajQ, UPF0234 family | Signal transduction mechanisms [T] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.18 % |
Unclassified | root | N/A | 1.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_106522320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3345 | Open in IMG/M |
3300001167|JGI12673J13574_1008794 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300001661|JGI12053J15887_10275878 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300002914|JGI25617J43924_10050838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1509 | Open in IMG/M |
3300003350|JGI26347J50199_1016703 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300004080|Ga0062385_10785962 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300004080|Ga0062385_10885684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 591 | Open in IMG/M |
3300004082|Ga0062384_100463637 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300004152|Ga0062386_101361884 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005171|Ga0066677_10000207 | All Organisms → cellular organisms → Bacteria | 20543 | Open in IMG/M |
3300005518|Ga0070699_100333875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1364 | Open in IMG/M |
3300005540|Ga0066697_10331758 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005541|Ga0070733_10198405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1312 | Open in IMG/M |
3300005554|Ga0066661_10142141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1464 | Open in IMG/M |
3300005555|Ga0066692_10093109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1774 | Open in IMG/M |
3300005560|Ga0066670_10010090 | All Organisms → cellular organisms → Bacteria | 4002 | Open in IMG/M |
3300005610|Ga0070763_10200110 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300005952|Ga0080026_10149900 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300006046|Ga0066652_100191357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1753 | Open in IMG/M |
3300006050|Ga0075028_100436133 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300006050|Ga0075028_100864619 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300006086|Ga0075019_11022114 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300006163|Ga0070715_10237764 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300006172|Ga0075018_10131231 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300006794|Ga0066658_10004093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5182 | Open in IMG/M |
3300006797|Ga0066659_11240236 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300007258|Ga0099793_10706527 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300007265|Ga0099794_10296070 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300009089|Ga0099828_11179338 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300009089|Ga0099828_11658071 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300009090|Ga0099827_10884042 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300009792|Ga0126374_10702528 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010366|Ga0126379_13749898 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300011270|Ga0137391_10156561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1985 | Open in IMG/M |
3300012096|Ga0137389_10962064 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300012199|Ga0137383_10081881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2333 | Open in IMG/M |
3300012199|Ga0137383_11076203 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300012203|Ga0137399_10068610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2651 | Open in IMG/M |
3300012203|Ga0137399_10504493 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300012203|Ga0137399_11334881 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300012207|Ga0137381_10090106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2587 | Open in IMG/M |
3300012209|Ga0137379_10210142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1860 | Open in IMG/M |
3300012209|Ga0137379_11353930 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300012209|Ga0137379_11410138 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012211|Ga0137377_10540959 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300012349|Ga0137387_10538694 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300012362|Ga0137361_10375992 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300012683|Ga0137398_11099297 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300012918|Ga0137396_10148050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
3300012918|Ga0137396_10393051 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300012918|Ga0137396_10587453 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300012923|Ga0137359_10227362 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300012923|Ga0137359_10407898 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300012924|Ga0137413_10416752 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300012925|Ga0137419_10757071 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300012927|Ga0137416_10183033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1669 | Open in IMG/M |
3300012929|Ga0137404_10744762 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300012944|Ga0137410_10238680 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300012948|Ga0126375_10268214 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300013832|Ga0120132_1106540 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300014153|Ga0181527_1304613 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300014166|Ga0134079_10581368 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300015051|Ga0137414_1213872 | All Organisms → cellular organisms → Bacteria | 2955 | Open in IMG/M |
3300015245|Ga0137409_10423103 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300016445|Ga0182038_11399927 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300017659|Ga0134083_10175338 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300017659|Ga0134083_10580498 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300017924|Ga0187820_1216736 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017932|Ga0187814_10358584 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300017975|Ga0187782_10443580 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300018001|Ga0187815_10478180 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300018032|Ga0187788_10359236 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300018482|Ga0066669_10035676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2994 | Open in IMG/M |
3300019789|Ga0137408_1440683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2794 | Open in IMG/M |
3300019890|Ga0193728_1350810 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300020060|Ga0193717_1052003 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300020580|Ga0210403_11232788 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300020582|Ga0210395_10100930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2135 | Open in IMG/M |
3300021171|Ga0210405_10509371 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300021405|Ga0210387_10282254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
3300021420|Ga0210394_11712746 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300021432|Ga0210384_11813502 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300021433|Ga0210391_10175724 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
3300021478|Ga0210402_11234278 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300025480|Ga0208688_1006088 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
3300025812|Ga0208457_1026682 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
3300026309|Ga0209055_1069755 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300026496|Ga0257157_1078995 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026557|Ga0179587_10227069 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300027655|Ga0209388_1145516 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300027698|Ga0209446_1056099 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300027737|Ga0209038_10175906 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300027768|Ga0209772_10150039 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300027846|Ga0209180_10680319 | Not Available | 561 | Open in IMG/M |
3300027862|Ga0209701_10005086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8646 | Open in IMG/M |
3300027879|Ga0209169_10152863 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300028536|Ga0137415_10611110 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300028536|Ga0137415_10833219 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300028906|Ga0308309_11324365 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300028906|Ga0308309_11515958 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300028906|Ga0308309_11703536 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031057|Ga0170834_107899235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3466 | Open in IMG/M |
3300031546|Ga0318538_10225503 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300031668|Ga0318542_10424223 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300031720|Ga0307469_10405874 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300032035|Ga0310911_10066657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
3300032180|Ga0307471_101492423 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300032205|Ga0307472_100061313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2404 | Open in IMG/M |
3300032770|Ga0335085_10496648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1394 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.18% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.27% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.45% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.64% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.73% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.91% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1065223204 | 3300000955 | Soil | FNVMAMAAHGRAVPGTLILQNTLYAVIYCAIVLTGAAAVFSRKNLK* |
JGI12673J13574_10087942 | 3300001167 | Forest Soil | FENFDVMGAAAHGRIIPATLVAQNTFYAVLYCAIVLTVAAAVFSQRNLK* |
JGI12053J15887_102758782 | 3300001661 | Forest Soil | AMAAHGRTVPDRLILQNTLYVVIYCAIVLAAAAAVFSRKNLK* |
JGI25617J43924_100508383 | 3300002914 | Grasslands Soil | AMAAHGRAVPGALILQNTLYTVVYCTIVLTAAASVFSRRNLK* |
JGI26347J50199_10167031 | 3300003350 | Bog Forest Soil | AHGRAIPGALILQNTAYAALYSGIVLLVAVAVFARRNLK* |
Ga0062385_107859621 | 3300004080 | Bog Forest Soil | LPNFENFNVTGLAAHGAKIPTALIAQNTLYAALYCTVVLAGAAAIFSRRNFK* |
Ga0062385_108856842 | 3300004080 | Bog Forest Soil | ENFNVTGLAAHGAKIPTALIAQNTLYAALYCAVVLAGAAAIFSRRNFK* |
Ga0062384_1004636371 | 3300004082 | Bog Forest Soil | NFNVTGLAAHGEKIPGALILQNTLYAGLYCAVVLAAAAAIFSRRNFK* |
Ga0062386_1013618842 | 3300004152 | Bog Forest Soil | FNVMGAVAHGRAVPGALVAQTTLYAVVYGAVVLAAAAAIFSRRNLK* |
Ga0066677_1000020720 | 3300005171 | Soil | NFENFNIMAMAAHSRQVPGTLIAQNTLYAAIYCAIVLTAAVVVFSRRNLK* |
Ga0070699_1003338751 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAHGRAVPGTLILQNTLYAVIYCAIVLTGAAVVFSRKNLK* |
Ga0066697_103317581 | 3300005540 | Soil | VMAMAAHGRVVPGALILQNTLYTVVYCTIVLSAAAAVFSRRNLK* |
Ga0070733_101984053 | 3300005541 | Surface Soil | ATHGRSIATLLIVQNTLYAAVYCAIVLAAAAVVFSRRDLK* |
Ga0066661_101421413 | 3300005554 | Soil | IMSMAAHARPVPGSLIAQNTLYAAVYCSIVLTAAVLVFSRRNLK* |
Ga0066692_100931093 | 3300005555 | Soil | NFENFNVMAMAAHGRVVPGALILQNTLYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0066670_100100904 | 3300005560 | Soil | VPGALILQNTVYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0070763_102001101 | 3300005610 | Soil | PNFENFNVMAAAAHGRAIPGALIIENTAYSALYSGIVLLVAAAVFSRRNLK* |
Ga0080026_101499001 | 3300005952 | Permafrost Soil | NFDVMGAAAHGRAIPGVLVAQNTLYAVIYCAMVLAVAAVIFSQRNLK* |
Ga0066652_1001913571 | 3300006046 | Soil | QVPGTLIAQNTLYAAIYCAIVLTAAVVVFSRRNLK* |
Ga0075028_1004361331 | 3300006050 | Watersheds | VMAMAAHGRAVPGALILQNTLYTVIYCTIVLTAAAAVFSRRNLK* |
Ga0075028_1008646192 | 3300006050 | Watersheds | FDVVAAAAHGRAVPAALIWQNTLYAALYCGIVLLAAAAVFSRRSLK* |
Ga0075019_110221142 | 3300006086 | Watersheds | VAIPHALILQNTLYAALYCTVVLAGAAIIFSRRNLK* |
Ga0070715_102377642 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAHGREIPSVLILQNTAYAVLYCGIVLTIAAAVFSRRNLK* |
Ga0075018_101312311 | 3300006172 | Watersheds | FDVVGAAAHGRAVPAALIWQNTLYAALYCGIVLLAAAAVFSRRNLK* |
Ga0070765_1004914632 | 3300006176 | Soil | NFENFDVMASAAHGRHIPGTLILHSTAYAVLYCVIVLAAASAIFSRRNLK* |
Ga0066658_100040934 | 3300006794 | Soil | VPGALILQNTLYAVVYCTIVLTAAAVVFSRRNLK* |
Ga0066659_112402362 | 3300006797 | Soil | VMAMAAHGRAIPGALILQNTLYVVIYCTIVLTAAAAVFSRRNLK* |
Ga0099793_107065271 | 3300007258 | Vadose Zone Soil | RAVPGVLIEQNTLYTVVYCTIVLMAAAAVFSRRNLK* |
Ga0099794_102960702 | 3300007265 | Vadose Zone Soil | RAVPGALILQNTLYAVVYCTIVLTAAAAVFSRRNLK* |
Ga0099828_111793382 | 3300009089 | Vadose Zone Soil | YGRTVPAKLILDNTLYAAVYAAIVLLAAAAAFSRRNLK* |
Ga0099828_116580711 | 3300009089 | Vadose Zone Soil | LLPNFENFNVMAMAAHGRAVPGASILQNTVYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0099827_108840422 | 3300009090 | Vadose Zone Soil | VPGALILQNTLYTVVYCAIVLTAAAAVFSRRNLK* |
Ga0126374_107025281 | 3300009792 | Tropical Forest Soil | VAAHGRSVPGALILQNTVYAILYCGIVLTAATVVFSRRNLK* |
Ga0126379_137498981 | 3300010366 | Tropical Forest Soil | TGPAAHGRSVPRALIWSNTLYAVLYCAIALVIAAAVFSRRDLK* |
Ga0137391_101565613 | 3300011270 | Vadose Zone Soil | LPNFENYNVMAAAAHGRAVPGALILENTAYTTVYCAIVLLIAATVFSRRNLK* |
Ga0137389_109620642 | 3300012096 | Vadose Zone Soil | IPGAFILQNTLYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0137383_100818813 | 3300012199 | Vadose Zone Soil | RAVPGALILQNTLYAVVYCTIVLTAAAVVFSRRNLK* |
Ga0137383_110762031 | 3300012199 | Vadose Zone Soil | AHGRAVPGALILQNTLYTVVYCTIVLAIASVVFSRRNLK* |
Ga0137399_100686103 | 3300012203 | Vadose Zone Soil | GRAVPGALILQNTLYAVVYCTIVLTAAAAVFSRRNLK* |
Ga0137399_105044932 | 3300012203 | Vadose Zone Soil | LAMAAHGRAVPGTLILQNTLYALIYCAIVLTCAAAVFSRKNLK* |
Ga0137399_113348812 | 3300012203 | Vadose Zone Soil | PNFEHFNVMAMDAHGLAVPGTLILQNTLYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0137381_100901061 | 3300012207 | Vadose Zone Soil | NFNVMAMAAHGRHVPRGFIVQNTLYAVVYCALALATAVIVFSRRNLK* |
Ga0137379_102101421 | 3300012209 | Vadose Zone Soil | NFNIMALAAHSRQVPRAFIAQNTLYAAVYCAIVLTAAILVFSKRNLK* |
Ga0137379_113539302 | 3300012209 | Vadose Zone Soil | AAHGRAVPGALILQNTLYTVVYCTIVLAIASVVFSRRNLK* |
Ga0137379_114101381 | 3300012209 | Vadose Zone Soil | NIMAMAAHSRQVPGTLIAQNTLYAAIYCAIVLTAAVVVFSRRNLK* |
Ga0137377_105409591 | 3300012211 | Vadose Zone Soil | KAVPGAFILQNTLYTLVYCTIILTAAAAVFSRRNLK* |
Ga0137387_105386942 | 3300012349 | Vadose Zone Soil | NFNVMAMAAHGRAVPGALILQNTVYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0137361_103759923 | 3300012362 | Vadose Zone Soil | YNVMAAAAHGRAVPGALILENTAYTAVYCAIVLLIAATVFSRRNLK* |
Ga0137398_110992972 | 3300012683 | Vadose Zone Soil | AMAAHGRAVPRALILQNTLYAVIYCTIVLTAAAVVFSRRDLK* |
Ga0137396_101480501 | 3300012918 | Vadose Zone Soil | NVMAMAAHGRAVPGTLILQNTLYAVIYCTIVLTGAAAVFSRKNLK* |
Ga0137396_103930512 | 3300012918 | Vadose Zone Soil | RAVPRALILQNTLYTVVYCTIVLTAAAVVFSRRDLK* |
Ga0137396_105874532 | 3300012918 | Vadose Zone Soil | DVMASASHGRAVPGALILENTIYTVVYCAIVLLAAAAVFSRRNLK* |
Ga0137359_102273621 | 3300012923 | Vadose Zone Soil | FENFNVMAMAAHGRAVPGMLMLQNTLYAVIYCAIMLTAAAAVFSRKNLK* |
Ga0137359_104078983 | 3300012923 | Vadose Zone Soil | FNVMAMAAHGRAVPGMLMLQNTLYAVIYCAIVLTGAAAVFSRKNLK* |
Ga0137413_104167522 | 3300012924 | Vadose Zone Soil | FENFNVMAMAAHGRAVPGALILQNTLYTVIYCTIVLTTAAAVFSRRNLK* |
Ga0137419_107570711 | 3300012925 | Vadose Zone Soil | NFENFNVMAMAAHGRAVPGTLILQNTLYAVIYCAIVLTGAAAAFSRKNLK* |
Ga0137416_101830331 | 3300012927 | Vadose Zone Soil | LPNFENFNVMALAAHGRAVPGALILQNTLYTVTYCAIVLTAAAAVFSRKNLK* |
Ga0137404_107447622 | 3300012929 | Vadose Zone Soil | ENFNVMAMAAHGRAVPGALILQNTLYAVVYCTIVLTAAAAVFSRRNLK* |
Ga0137410_102386801 | 3300012944 | Vadose Zone Soil | NFENFNVMAIAAHGRAVPGALILQNTLYAVVYCTIVLTAAAAVFSRRNLK* |
Ga0126375_102682141 | 3300012948 | Tropical Forest Soil | NVMAQAAHGRQVPGALIVQNTLYAVIYSSIVLAAAMMVFSRRNLK* |
Ga0120132_11065401 | 3300013832 | Permafrost | EAIERAAAHGRAIPGALIVQNTLYAVIYCSIILALAAAIFSQRNLK* |
Ga0181527_13046131 | 3300014153 | Bog | VPEALVAQATLYAVVYGAVVLAAAAAIFSRRNLK* |
Ga0134079_105813681 | 3300014166 | Grasslands Soil | LPNFENFNVMAMAAHGRVVPGALILQNTWYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0137414_12138723 | 3300015051 | Vadose Zone Soil | MAMAAHGRAVPGALILQDTLYTVVYCTIVLTAAAAVFSRRNLK* |
Ga0137409_104231031 | 3300015245 | Vadose Zone Soil | FENFNVMAMAAHGRAVPGTLILQNTLYVVIYCAIVLTGAAAVFSRKNLK* |
Ga0182038_113999271 | 3300016445 | Soil | TGAVAHGRGVPGSLVWHVTVYTVVYCAVVLAGASAVFARRNLK |
Ga0134083_101753382 | 3300017659 | Grasslands Soil | HGRAVPGALILQNTLYTVVYCTIVLAIASVVFSRRNLK |
Ga0134083_105804981 | 3300017659 | Grasslands Soil | HGRAVPGALVLQNTLYTLVYCTIVLTAAAAVFSRRNLK |
Ga0187820_12167361 | 3300017924 | Freshwater Sediment | HGRVVPGSLILHNTLYALVYCAVVLTAAVAVFSRRNLK |
Ga0187814_103585842 | 3300017932 | Freshwater Sediment | HARAIPGSLILHNTLYAVVYCAIVLTAAVAVFSRRNLK |
Ga0187782_104435801 | 3300017975 | Tropical Peatland | AAHGRFVPGSLILQTTLYTVLYSAVLLAGAVLVFSRRNLK |
Ga0187815_104781802 | 3300018001 | Freshwater Sediment | QAIPGILILENTLYTLVYCAIVLTVAAVVFSRRDLK |
Ga0187788_103592361 | 3300018032 | Tropical Peatland | NFDVVGAAAHGRSVPAELIWQNTLYAALYCAIVLLAAAMVFSRRNLK |
Ga0066669_100356761 | 3300018482 | Grasslands Soil | IMAQAAHSWPVAGAFIAQNTLYAAVYCTIVLTAAILVFSRRNLK |
Ga0137408_14406834 | 3300019789 | Vadose Zone Soil | MALLPPSKFENFNVMAMAAHGRAVPGALILQNTLYAVVYCTIVLTAAAAVFSRRNLK |
Ga0193728_13508101 | 3300019890 | Soil | PNFENFDVTGAAAHGRAIPGSLIAQNSLYAIIYCSIMLALAAIIFSRRDLK |
Ga0193717_10520033 | 3300020060 | Soil | NFNVMAAAAHARKVPGELIFQNTVYAAVYCALLLIIASLVFSRRNLK |
Ga0210403_112327881 | 3300020580 | Soil | LLPNFDDFDVMAAATHGRSIAGVLILQNTIYAAVYCAIVLAAAAVVFSRRDLK |
Ga0210395_101009301 | 3300020582 | Soil | SYFLPNFENFNVMAAAAHGREIPGALILQNTTYAVLYSGIVLLVAAAVFSRRNLK |
Ga0210405_105093711 | 3300021171 | Soil | NFDVMASAVHGRAIPGALILENTIYTVVYCAIVLLTAATVFSRRNLK |
Ga0210387_102822543 | 3300021405 | Soil | AHGIAIPGALILQNTLYTLLYSVIVLIASAAVFSGRNLK |
Ga0210394_117127461 | 3300021420 | Soil | AHGGVVPGALILNATLYALVYCAIVLTGAAAIFSRRNLK |
Ga0210384_118135021 | 3300021432 | Soil | NFDVLGAAAHGRAVPGTLIWQNTLYAALYCAIVLLAAAAVFSRRNLK |
Ga0210391_101757243 | 3300021433 | Soil | NYNVLALAAHGRAVPGALILQNTLYTFIYCAVVLCVASVVFSRKNLK |
Ga0210402_112342782 | 3300021478 | Soil | ESFNVMAAAAHGRDIPAALILQNMAYAVLYSGIVLLVAAAVFSRRNLK |
Ga0208688_10060884 | 3300025480 | Peatland | AVSGALVEQATLYAVVYGAVVLAAAAAIFSRRNLK |
Ga0208457_10266821 | 3300025812 | Peatland | GRAVPEALVAQATLYAVVYGAVVLAAAAAIFSRRNLK |
Ga0209055_10697553 | 3300026309 | Soil | NIMSMAAHARPVPGSLIAQNTLYAAVYCSIVLTAAVLVFSRRNLK |
Ga0257157_10789952 | 3300026496 | Soil | FENYNVMAMAAHGRAVPGVLIEQNTLYTVVYCTIVLMAAAAVFSRRNLK |
Ga0179587_102270692 | 3300026557 | Vadose Zone Soil | HGRAVPGALILQNTLYTVIYCAIVLTAAAAVFSRRNLK |
Ga0209388_11455162 | 3300027655 | Vadose Zone Soil | NFDVMAAAAHGRAIPGVLIAQNTAYTALYCAVVLTAAAAIFTRRNLK |
Ga0209446_10560992 | 3300027698 | Bog Forest Soil | EIPSALILQNTAYAALYCVIVLLIAAAVFSRRNLK |
Ga0209038_101759061 | 3300027737 | Bog Forest Soil | NFENFNVTGLAAHGERIPGALILQNTLYAGLYCAVVLAAAAAIFSRRNFK |
Ga0209772_101500391 | 3300027768 | Bog Forest Soil | YVLPNFENFNVTGPVAHGVAIPSALIVQNTLYAAIYCTVVMATAAAIFSRGNLK |
Ga0209180_106803191 | 3300027846 | Vadose Zone Soil | LPNFENFNVMAIAAHGRAVPGALILQNTLYTVVYCTIVLTAAAAVFSRRNLK |
Ga0209701_100050868 | 3300027862 | Vadose Zone Soil | AMAAHGRAVPGALILQNTLYTVVYCTIVLAIASVVFSRRNLK |
Ga0209169_101528633 | 3300027879 | Soil | SSNVMAAAAHGRAIPGALIIENTAYSALYSGIVLLVAAAVFSRRNLK |
Ga0137415_106111102 | 3300028536 | Vadose Zone Soil | AHGRAVPGALMLQNTLYTVIYCAIVLTAAAAVFSRKNLK |
Ga0137415_108332192 | 3300028536 | Vadose Zone Soil | ENFNVMAMAAHGRTVPGVLILQNTVYTVIYCTIVLTAAAAVFSRRNLK |
Ga0308309_113243652 | 3300028906 | Soil | LPNFENFNVMALAAHGRAVPGALILQNTAYTVVYCTIVLTAAAAVFSRRNLK |
Ga0308309_115159581 | 3300028906 | Soil | VHGREIPGALILENTAYAALYSGIVLLVAAAVFSRRNLK |
Ga0308309_117035361 | 3300028906 | Soil | FNVMAAAAHGREIPAAMILQNTVYAALYSGIVLLVAAAVFSRRNLK |
Ga0170834_1078992353 | 3300031057 | Forest Soil | FDVMGAAAHGRVISGMLIAQNTVYASLYCAIVLTVAMAIFSQRNLK |
Ga0318538_102255031 | 3300031546 | Soil | RQVSGALIVQNTLYAAIYSAIVLTAAVVVFSRRNLK |
Ga0318542_104242232 | 3300031668 | Soil | GRGVPGSLVWHVTVYTVVYCAVVLAGASAVFARRNLK |
Ga0307469_104058742 | 3300031720 | Hardwood Forest Soil | LPNFENFNVMAMAAHGQAVPGTLILQNTLYAVMYCAIVLTSAAAVFSRKNLK |
Ga0310911_100666571 | 3300032035 | Soil | AHSRQVSGALIVQNTLYAAIYSAIVLTAAVVVFSRRNLK |
Ga0307471_1014924232 | 3300032180 | Hardwood Forest Soil | NFNVMAMAAHGRAVPGALILQNTLYAVVYCTIVLTTAAAVFSRRNLK |
Ga0307472_1000613133 | 3300032205 | Hardwood Forest Soil | NFENFNIMAMAAHSRPVPGALVAQNTLYAAVYCAIVLTGAVLVFSRRNLK |
Ga0335085_104966483 | 3300032770 | Soil | IMASATHNTPVPSSLILQNTAYAVLYCAIILSAAVVVFSRRNLK |
⦗Top⦘ |