NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087782

Metagenome / Metatranscriptome Family F087782

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087782
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 150 residues
Representative Sequence MSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGTEVSVSPDMELDDMGRVLAHDGVNYFMIPMEEIIFVGSN
Number of Associated Samples 88
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 41.82 %
% of genes from short scaffolds (< 2000 bps) 71.82 %
Associated GOLD sequencing projects 73
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.818 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(62.727 % of family members)
Environment Ontology (ENVO) Unclassified
(92.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.18%    β-sheet: 19.87%    Coil/Unstructured: 42.95%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF04308RNaseH_like 43.64
PF13620CarboxypepD_reg 0.91



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms54.55 %
UnclassifiedrootN/A45.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001450|JGI24006J15134_10013621Not Available3900Open in IMG/M
3300001450|JGI24006J15134_10035271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2157Open in IMG/M
3300001450|JGI24006J15134_10172476Not Available686Open in IMG/M
3300002484|JGI25129J35166_1013569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2023Open in IMG/M
3300002484|JGI25129J35166_1041075All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300002514|JGI25133J35611_10050035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1416Open in IMG/M
3300002518|JGI25134J35505_10024241All Organisms → Viruses → Predicted Viral1807Open in IMG/M
3300002519|JGI25130J35507_1003144All Organisms → cellular organisms → Bacteria4782Open in IMG/M
3300004280|Ga0066606_10306989Not Available560Open in IMG/M
3300005516|Ga0066831_10099529All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium787Open in IMG/M
3300005838|Ga0008649_10234799Not Available702Open in IMG/M
3300006164|Ga0075441_10003296Not Available7421Open in IMG/M
3300006750|Ga0098058_1017263All Organisms → Viruses → Predicted Viral2131Open in IMG/M
3300006751|Ga0098040_1253096Not Available510Open in IMG/M
3300006752|Ga0098048_1026766All Organisms → cellular organisms → Bacteria1897Open in IMG/M
3300006754|Ga0098044_1154464Not Available919Open in IMG/M
3300006754|Ga0098044_1281713Not Available639Open in IMG/M
3300006789|Ga0098054_1022215All Organisms → cellular organisms → Bacteria2519Open in IMG/M
3300006793|Ga0098055_1119173Not Available1025Open in IMG/M
3300006793|Ga0098055_1274828Not Available631Open in IMG/M
3300006922|Ga0098045_1003280All Organisms → cellular organisms → Bacteria5232Open in IMG/M
3300006924|Ga0098051_1187339Not Available542Open in IMG/M
3300006925|Ga0098050_1034374All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300006926|Ga0098057_1028270All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300006927|Ga0098034_1038301All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300006927|Ga0098034_1146405Not Available667Open in IMG/M
3300007229|Ga0075468_10001595All Organisms → cellular organisms → Bacteria9676Open in IMG/M
3300007276|Ga0070747_1047594All Organisms → cellular organisms → Bacteria1649Open in IMG/M
3300007510|Ga0105013_1088076All Organisms → cellular organisms → Bacteria2296Open in IMG/M
3300007758|Ga0105668_1000538All Organisms → cellular organisms → Bacteria4404Open in IMG/M
3300008050|Ga0098052_1043945All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1957Open in IMG/M
3300008952|Ga0115651_1098349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2183Open in IMG/M
3300009173|Ga0114996_10924653Not Available623Open in IMG/M
3300009193|Ga0115551_1514156Not Available510Open in IMG/M
3300009420|Ga0114994_10408766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium898Open in IMG/M
3300009425|Ga0114997_10059989All Organisms → cellular organisms → Bacteria2415Open in IMG/M
3300009425|Ga0114997_10108550Not Available1685Open in IMG/M
3300009425|Ga0114997_10279832Not Available930Open in IMG/M
3300009705|Ga0115000_10150161Not Available1552Open in IMG/M
3300009785|Ga0115001_10619525Not Available660Open in IMG/M
3300010149|Ga0098049_1005390Not Available4551Open in IMG/M
3300010883|Ga0133547_10816626All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1829Open in IMG/M
3300010883|Ga0133547_11105824All Organisms → cellular organisms → Bacteria1523Open in IMG/M
3300012950|Ga0163108_10760758Not Available626Open in IMG/M
3300014818|Ga0134300_1064559Not Available650Open in IMG/M
3300017703|Ga0181367_1009358All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300017704|Ga0181371_1008110All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300017705|Ga0181372_1070590Not Available591Open in IMG/M
3300017709|Ga0181387_1014028All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300017714|Ga0181412_1139158Not Available551Open in IMG/M
3300017715|Ga0181370_1016931All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300017717|Ga0181404_1174657Not Available515Open in IMG/M
3300017720|Ga0181383_1017827All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1907Open in IMG/M
3300017730|Ga0181417_1096087Not Available717Open in IMG/M
3300017731|Ga0181416_1133909Not Available596Open in IMG/M
3300017743|Ga0181402_1151164Not Available588Open in IMG/M
3300017760|Ga0181408_1032701All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1419Open in IMG/M
3300017767|Ga0181406_1074925All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300017775|Ga0181432_1005468All Organisms → cellular organisms → Bacteria2950Open in IMG/M
3300020165|Ga0206125_10130919Not Available1027Open in IMG/M
3300020595|Ga0206126_10072105All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300022164|Ga0212022_1009071All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1372Open in IMG/M
3300022178|Ga0196887_1003089Not Available6483Open in IMG/M
(restricted) 3300022888|Ga0233428_1020671All Organisms → cellular organisms → Bacteria3220Open in IMG/M
(restricted) 3300023276|Ga0233410_10100232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium897Open in IMG/M
(restricted) 3300024257|Ga0233442_1024066All Organisms → Viruses → Predicted Viral2168Open in IMG/M
3300025066|Ga0208012_1004444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2943Open in IMG/M
3300025066|Ga0208012_1009567All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300025066|Ga0208012_1036900Not Available742Open in IMG/M
3300025078|Ga0208668_1070587Not Available628Open in IMG/M
3300025082|Ga0208156_1081390Not Available604Open in IMG/M
3300025084|Ga0208298_1004691All Organisms → cellular organisms → Bacteria3960Open in IMG/M
3300025084|Ga0208298_1092371Not Available554Open in IMG/M
3300025084|Ga0208298_1095636Not Available541Open in IMG/M
3300025096|Ga0208011_1000206All Organisms → cellular organisms → Bacteria25106Open in IMG/M
3300025103|Ga0208013_1055239All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1069Open in IMG/M
3300025109|Ga0208553_1032919All Organisms → cellular organisms → Bacteria1327Open in IMG/M
3300025112|Ga0209349_1004371All Organisms → cellular organisms → Bacteria6264Open in IMG/M
3300025114|Ga0208433_1083703Not Available808Open in IMG/M
3300025118|Ga0208790_1148293Not Available650Open in IMG/M
3300025122|Ga0209434_1004183Not Available6051Open in IMG/M
3300025133|Ga0208299_1161195Not Available696Open in IMG/M
3300025141|Ga0209756_1019852All Organisms → cellular organisms → Bacteria3927Open in IMG/M
3300025141|Ga0209756_1043481All Organisms → cellular organisms → Bacteria2265Open in IMG/M
3300025141|Ga0209756_1054622Not Available1926Open in IMG/M
3300025168|Ga0209337_1036015Not Available2692Open in IMG/M
3300025168|Ga0209337_1040130All Organisms → cellular organisms → Bacteria2512Open in IMG/M
3300025168|Ga0209337_1099248All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300026209|Ga0207989_1138047Not Available578Open in IMG/M
3300027668|Ga0209482_1088871Not Available1016Open in IMG/M
3300027714|Ga0209815_1030158All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300027779|Ga0209709_10098053All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300027779|Ga0209709_10180768Not Available1001Open in IMG/M
3300027801|Ga0209091_10084068All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1742Open in IMG/M
3300028125|Ga0256368_1065691Not Available626Open in IMG/M
3300028188|Ga0257124_1109119Not Available774Open in IMG/M
3300028277|Ga0257116_1076026Not Available929Open in IMG/M
3300028436|Ga0256397_1008121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1102Open in IMG/M
3300031519|Ga0307488_10592042Not Available645Open in IMG/M
3300031601|Ga0307992_1311459Not Available544Open in IMG/M
3300031603|Ga0307989_1081773Not Available548Open in IMG/M
3300031621|Ga0302114_10129403All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300031627|Ga0302118_10085470All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300031627|Ga0302118_10135302All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1211Open in IMG/M
3300031627|Ga0302118_10140665Not Available1183Open in IMG/M
3300031627|Ga0302118_10187571All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium996Open in IMG/M
3300031766|Ga0315322_10037060All Organisms → cellular organisms → Bacteria3621Open in IMG/M
3300032088|Ga0315321_10348591All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300032138|Ga0315338_1011224All Organisms → cellular organisms → Bacteria5013Open in IMG/M
3300032138|Ga0315338_1016506All Organisms → cellular organisms → Bacteria3699Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine62.73%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.09%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.64%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.64%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.64%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.73%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.73%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.82%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.82%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.82%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.91%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.91%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.91%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.91%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.91%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.91%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300002484Marine viral communities from the Pacific Ocean - ETNP_2_130EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007510Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007758Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012950Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaGEnvironmentalOpen in IMG/M
3300014818Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubationEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017715Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022888 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024257 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_150_MGEnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025078Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025112Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes)EnvironmentalOpen in IMG/M
3300025114Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300026209Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028188Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_150EnvironmentalOpen in IMG/M
3300028277Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120mEnvironmentalOpen in IMG/M
3300028436Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - Kryos LI F3EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031603Marine microbial communities from Ellis Fjord, Antarctic Ocean - #185EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032138Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - ASW #8EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24006J15134_1001362143300001450MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVDRGTEVSVSPDMELDSMGRVLAHDGVNYFMIPMEEIIFVGSN*
JGI24006J15134_1003527143300001450MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNNGENYDIYPYMNDGNLFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSISPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN*
JGI24006J15134_1017247623300001450MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIAEAYNNGENYDIYPYMGEDKLFNKTQNVDAAIISAFLSSYVKELEMRLKNTQPSKCKLISGSGSAYFYNPVTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGANYFLLPMEEIIFVGSN*
JGI25129J35166_101356943300002484MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN*
JGI25129J35166_104107513300002484MarineAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVIFVGDN*
JGI25133J35611_1005003533300002514MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIFPYIDSEAFSEKTKNMDSVIISAFLSTYIKELGTQLNKMQPSKHKLISGSGPAYFYNPTTKEFVKVERGSEVSVSPDMKLDELGRVLAHDGANYFMIPLEEIIFAGYN*
JGI25134J35505_1002424153300002518MarineERLAEYLEEQMAEAYNTGENYNVYPYLNDNGLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPIEEVIFVGDN*
JGI25130J35507_100314453300002519MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEAXNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGAN*
Ga0066606_1030698913300004280MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSISPDMELDDMGRVLAHDGVNYFMIPMEEIIFVGSN*
Ga0066831_1009952923300005516MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVN
Ga0008649_1023479913300005838MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMIPMEEIIFVGSN*
Ga0075441_1000329653300006164MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNNGENYNIYPYMNSDDLFNKTQNIDAAIISAFISSYVKELETRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMNLDEMGRVLAHDGVNYFLLPMEDIIFIGDN*
Ga0098058_101726313300006750MarinePEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEIIFVGDN*
Ga0098040_125309613300006751MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMEL
Ga0098048_102676653300006752MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLNKTQNVDAAIISAFLSSYVKELGKQLKDALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVILVGAN*
Ga0098044_115446423300006754MarineMSNDDENIPEGDNKDVFDINEVLAEERLAEYLEEQISEAYNTGENYDIYPYLSDRNPKKKSKNMDSAIISAFLSTYIKELETRLMKVQPSKHKLISGSGPAYFYNPVTKEFVKVERGSEVSVSPEMELDDLGRVLASDGINYFMIPIEEIIFAGYN*
Ga0098044_128171313300006754MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLKKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFIGSN*
Ga0098054_102221543300006789MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLKKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFIGSN*
Ga0098055_111917313300006793MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLNKTQNVDAAIISAFLSSYVKELGKQLKDALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPIEEVIFVGDN*
Ga0098055_127482813300006793MarineVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFIGSN*
Ga0098045_100328043300006922MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVKELGKQLKDALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVIFVGAN*
Ga0098051_118733913300006924MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDM
Ga0098050_103437423300006925MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLNKTQNVDAAIISAFLSSYVKELGKQLKDALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVIFVGAN*
Ga0098057_102827013300006926MarineYTMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN*
Ga0098034_103830133300006927MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN*
Ga0098034_114640523300006927MarineMSNDDENIPEGDNEGVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMI
Ga0075468_1000159533300007229AqueousMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELENRLKNAQPSKCKLISGSGPAYFYNPVTKEFVKVARGSEVSVSPDMELDNMGRVLAHDGVNYFMIPMEEIIFIGSN*
Ga0070747_104759433300007276AqueousMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGTEVSVSPDMELDDMGRVLAHDGVNYFMIPMEEIIFVGSN*
Ga0105013_108807633300007510MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQISEAYDTGENYNVYPYINNDDLSKKTQNVDAAIISAFLSSYVKELEKQLKNVQPSKHKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVLAHDGANYFMIPLEEIIFVDAN*
Ga0105668_100053863300007758Background SeawaterMSNDDENIPEGDNEDVFDIDEVLAEERLAEYLEEQIAEAYNTGENYDIYPYLSESGLFGKPHNVDAAILSEFISSYVKELEIQLKDAQPSKCKLISGSGPAYFYNPSTKEFVKVERGTEVYVSDNPELDDLGRVLAHDGVNFFLVPLEEIIIAGFN*
Ga0098052_104394543300008050MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLKKAKNMDSEIISAFLSSYVKELEVRLKNTQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFIGSN*
Ga0115651_109834953300008952MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIAEAYDTGENYNVYPYINNDDLSKKTQNVDAAIISAFLSSYVKELEKQLKNVQPSKHKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVLAHDGANYFMIPLEEIIFVDAN*
Ga0114996_1092465313300009173MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNNGENYDIYPYIGDGNLFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSISPEMDLDEMGRVLAHDGVNYFL
Ga0115551_151415613300009193Pelagic MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIAEAYDSGENYNVYPYVENDNIYSASKNHDKAIISAFLSSYVKELGKQLKNVQPSKHRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPEMELD
Ga0114994_1040876613300009420MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDSENDDVYPFMGEGNLFSKTQNVDAAIISSFVSAYVKELEIRLKSTQPSKCRLISGSGPAYFYNPITKEFVKVERGTEVSVSPEMDVDDMGRVMAHDGVNYFMLPLDEIVFVGHN*
Ga0114997_1005998943300009425MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYKNGENYEVYPYISEGDLFNKNQNVDAAVISAFLSSYVKELEIRLKDTQPSKCRFISGSGPAYFYNPVSKEFVKVERGTEVSVSPEMDADELGRVLAHDGANYFMMPLDEIVFIGHN*
Ga0114997_1010855013300009425MarineMSNDDENIPEGDKEDVFDISEALAEERLAEYIEEQIAEAYNTGENYDIYPYMSDSGLFKKPKNIDSSIMSTFVLSYVKELEIRLKKAQPSKCKLISGSGPAYFYNPATKEFVKVERGTEVSVSPDMDIDDLGRVLAYDGTNYFMIPLDEIVFLGYN*
Ga0114997_1027983213300009425MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDGENYDIYPYMSGGALFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN*
Ga0115000_1015016113300009705MarineDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDGENYDIYPYMSGGALFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN*
Ga0115001_1061952513300009785MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDGENYDIYPYMSGGALFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSISPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN*
Ga0098049_100539013300010149MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLNKTQNVDAAIISAFLSSYVKELGKQLKDALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDM
Ga0133547_1081662633300010883MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDGENYDIYPYMSGGALFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN*
Ga0133547_1110582453300010883MarineENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEACNSGENYDIYPYMNDGALFNKTQNVDAAIISSFLSSYVKELEIRLKNAQPSKCRLISGSGPAYFYNPTTKEFVKVECGTEVSVSPEMELDSLGRVLAHDGVNYFMLPLDEIIFVGHN*
Ga0163108_1076075813300012950SeawaterMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISCSGPAYFYNPATKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVILVGAN*
Ga0134300_106455913300014818MarineINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPEMELDSLGRVLAHDGVNYFMIPMEEIIFVGSN*
Ga0181367_100935813300017703MarineENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEIIFVGDN
Ga0181371_100811023300017704MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPIEEVIFVGDN
Ga0181372_107059013300017705MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNGLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMEL
Ga0181387_101402813300017709SeawaterMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0181412_113915823300017714SeawaterLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0181370_101693113300017715MarineLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN
Ga0181404_117465713300017717SeawaterEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0181383_101782743300017720SeawaterMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVN
Ga0181417_109608713300017730SeawaterMSSDDENIPEGDNEDVFDINEMLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVG
Ga0181416_113390913300017731SeawaterMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIFPYIDGEAFSEKTKNMDSVIISAFLSTYIKELGTRLNKMQPSKHKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELD
Ga0181402_115116423300017743SeawaterEDVFDINEMLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLKKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0181408_103270113300017760SeawaterMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIFPYIDSEAFSEKTKNMDSVIISAFLSTYIKELGTQLNKMQPSKHKLISGSGPAYFYNPTTKEFVKVERGSEVSVSPDMELDELGRVLAHDGANYFMIPLEEIIFAGYN
Ga0181406_107492513300017767SeawaterRGDEMLAEERLAEYIEEQIAEAYNTGENYDIFPYIDSEAFSEKTKNMDSVIISAFLSTYIKELGTRLNKMQPSKHKLISGSGPAYFYNPTTKEFVKVERGSEVSVSPDMELDELGRVLAHDGANYFMIPLEEIIFAGYN
Ga0181432_100546843300017775SeawaterMSNDDENIPEGDNEGVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVIFVGDN
Ga0206125_1013091923300020165SeawaterMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMIPMEEIIFIGSN
Ga0206126_1007210523300020595SeawaterMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELENRLKNAQPSKCKLISGSGPAYFYNPVTKEFVKVARGSEVSVSPDMELDNMGRVLAHDGVNYFMLPMEEIIFIGSN
Ga0212022_100907133300022164AqueousMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPVTKEFVKVARGSEVSVSPDMELDNMGR
Ga0196887_100308963300022178AqueousMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELENRLKNAQPSKCKLISGSGPAYFYNPVTKEFVKVARGSEVSVSPDMELDNMGRVLAHDGVNYFMIPMEEIIFIGSN
(restricted) Ga0233428_102067153300022888SeawaterMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIIFVGHN
(restricted) Ga0233410_1010023213300023276SeawaterMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDG
(restricted) Ga0233442_102406663300024257SeawaterAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIIFVGHN
Ga0208012_100444423300025066MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPIEEVIFVGDN
Ga0208012_100956733300025066MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLKKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFIGSN
Ga0208012_103690023300025066MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNGLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEIIFVGDN
Ga0208668_107058713300025078MarineYTMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN
Ga0208156_108139023300025082MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELD
Ga0208298_100469153300025084MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLNKTQNVDAAIISAFLSSYVKELGKQLKDALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVIFVGAN
Ga0208298_109237113300025084MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMEL
Ga0208298_109563613300025084MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLKKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVN
Ga0208011_1000206173300025096MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGEDYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVILVGAN
Ga0208013_105523913300025103MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDME
Ga0208553_103291933300025109MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNGLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN
Ga0209349_100437163300025112MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN
Ga0208433_108370313300025114MarineDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNGLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGDN
Ga0208790_114829323300025118MarinePYLGNDYIMSNDDENIPEGDNKDVFDINEVLAEERLAEYLEEQISEAYNTGENYDIYPYLSDRNPKKKSKNMDSAIISAFLSTYIKELETRLMKVQPSKHKLISGSGPAYFYNPVTKEFVKVERGSEVSVSPEMELDDLGRVLASDGINYFMIPIEEIIFAGYN
Ga0209434_100418353300025122MarineMSNDDENIPEGDSEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEVIFVGAN
Ga0208299_116119513300025133MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQMAEAYNTGENYNVYPYLNDNDLPNEPRDVNKAIISAFVSSYVKELEKQLKTVQPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDD
Ga0209756_101985223300025141MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVFAHDGVNYFMIPIEEIIFVGDN
Ga0209756_104348133300025141MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIFPYIDSEAFSEKTKNMDSVIISAFLSTYIKELGTQLNKMQPSKHKLISGSGPAYFYNPTTKEFVKVERGSEVSVSPDMKLDELGRVLAHDGANYFMIPLEEIIFAGYN
Ga0209756_105462233300025141MarineMSNDDENIPEGDNKDVFDINEVLAEERLAEYLEEQISEAYNTGENYDIYPYLSDRNPKKKSKNMDSAIISAFLSTYIKELETRLMKVQPSKHKLISGSGPAYFYNPVTKEFVKVERGSEVSVSPEMELDDLGRVLASDGINYFMIPIEEIIFAGYN
Ga0209337_103601533300025168MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNNGENYDIYPYMNDGNLFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSISPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN
Ga0209337_104013043300025168MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVDRGTEVSVSPDMELDSMGRVLAHDGVNYFMIPMEEIIFVGSN
Ga0209337_109924813300025168MarineEGDNEDVFDINEVLAEERLAEYLEEQIAEAYNNGENYDIYPYMGEDKLFNKTQNVDAAIISAFLSSYVKELEMRLKNTQPSKCKLISGSGSAYFYNPVTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGANYFLLPMEEIIFVGSN
Ga0207989_113804713300026209MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLSKTQNVDAAIISAFLSSYVEELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEVIFV
Ga0209482_108887123300027668MarineMSSDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNNGENYNIYPYMNSDDLFNKTQNIDAAIISAFISSYVKELETRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMNLDEMGRVLAHDGVNYFLLPMEDIIFIGDN
Ga0209815_103015853300027714MarineMSSDDENIPEGDNEDVFDINEALAEERLAEYIEEQIAEAYNTGENYNIYPYMSDGALFEKPKNVDSAIISAFVSSYVKELEIQLKKAQPSKCRLISGSGPAYFYSPVTKDFVKAERGTEVSVSPDMEIDDLGRVLAYDGTNYFMLPLDEIMFIGHN
Ga0209709_1009805313300027779MarineNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYKNGENYEVYPYISEGDLFNKNQNVDAAVISAFLSSYVKELEIRLKDTQPSKCRFISGSGPAYFYNPVSKEFVKVERGTEVSVSPEMDADELGRVLAHDGANYFMMPLDEIVFIGHN
Ga0209709_1018076813300027779MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDGENYDIYPYMSGGALFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMNLDEMGRVLAHDGVNYFLLPMEDIIFVGYN
Ga0209091_1008406833300027801MarineMSSDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDGENYDIYPYMSGGALFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPVSKEFVKVARGSEVSVSPEMDLDEMGRVLAHDGVNYFLLPMEDIIFVGYN
Ga0256368_106569113300028125Sea-Ice BrineNDDENIPEGDDEDVFDINEVLAEERLAEYIEEQIAEAYNDSENDDVYPFMGEGNLFSKTQNVDAAIISSFVSAYVKELEIRLKSTQPSKCRLISGSGPAYFYNPITKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIILVGHN
Ga0257124_110911923300028188MarineTMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIIFVGHN
Ga0257116_107602623300028277MarinePLLGNDYTMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNAGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIIFVGHN
Ga0256397_100812123300028436SeawaterMSNDDENIPEGDNEDVFDINEVLAEERLAEYLEEQIAEAYNTGENYNVYPYIGNSSLSDKTQNIDKEIISAFISSYVKELEKQLKNVLPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRVLAHDGVNYFMIPMEEIIFVGTN
Ga0307488_1059204213300031519Sackhole BrineMSNDDENIPEGDDEDVFDINEVLAEERLAEYIEEQIAEAYNDSENDDVYPFMGEGNLFSKTQNVDAAIISSFVSAYVKELEIRLKSTQPSKCRLISGSGPAYFYNPITKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIILVGHN
Ga0307992_131145913300031601MarineMSSDDENIPEGDNEDVFDINEALAEERLAEYIEEQIAEAYNTGENYNIYPYMSDGALFEKPKNVDSAIISAFVSSYVKELEIQLKKAQPSKCRLISGSGPAYFYSPVTKDFVKAERGTEVSVSPDMEIDDLGRVLAYDGTNYFMMPLDEIMFIGYN
Ga0307989_108177313300031603MarineMSNDDENIPEGDNEDVFDISEALAEERLAEYIEEQIAEAYNTGENYNIYPYMSDGGLFEKPKNVDSAIISAFVSSYVKELEIQLKKAQPSKCKLISGSGPAYFYSPVTKDFVKAERGTEVSVSPDMEIDDLGRVLAYDGTNYFMLPLDEIMFIGYN
Ga0302114_1012940323300031621MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDSENDDVYPFMGEGNLFSKTQNVDAAIISSFVSAYVKELEIRLKSTQPSKCRLISGSGPAYFYNPITKEFVKVERGTEVSVSPELDVDELGRVLAHDGVNYFMLPLDEIIFVGHN
Ga0302118_1008547043300031627MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYKNGENYEVYPYISEGDLFNKNQNVDAAVISAFLSSYVKELEIRLKDTQPSKCRFISGSGPAYFYNPVSKEFVKVERGTEVSVSPEMDADELGRVLAHDGANYFMMPLDEIVFIGHN
Ga0302118_1013530223300031627MarineMSSDDENIPKGDSEDVFDINEVLAEERLAEYIEEQIAEAYNNGENYDIYPYIGDGNLFNKTQNVDAAIISSFLSSYVKELEIRLKNTQPSKCKLISGSGPAYFYNPISKEFVKVARGSEVSVSPEMNLDEMGRVLAHDGVNYFLLPMEDIIFVGAN
Ga0302118_1014066523300031627MarineMSNDDENIPEGDKEDVFDISEALAEERLAEYIEEQIAEAYNTGENYDIYPYMSDSGLFKKPKNIDSSIMSTFVLSYVKELEIRLKKAQPSKCKLISGSGPAYFYNPATKEFVKVERGTEVSVSPDMDIDDLGRVLAYDGTNYFMIPLDEIVFLGYN
Ga0302118_1018757133300031627MarineMSNDDENIPEGDNEDVFDINEVLAEERLAEYIEEQIAEAYNDSENDDVYPFTGEGNLFSKTQNVDAAIISSFVSAYVKELEIRLKSTQPSKCRLISGSGPAYFYNPITKEFVKVERGTEVSVSPELDVDE
Ga0315322_1003706023300031766SeawaterMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDSEALLKKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0315321_1034859113300032088SeawaterYIEEQIAEAYNTGENYDIYPYIDSEALLNKAKNMDSAIISAFLSSYVKELEVRLENAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0315338_101122443300032138SeawaterMSNDDENIPEGDSEDVFDINEVLAEERLAEYIEEQIAEAYNTGENYDIYPYIDGEALLKKAKNMDSAIISAFLSSYVKELEVRLKNAQPSKCKLISGSGPAYFYNPTTKEFVKVARGSEVSVSPDMELDSMGRVLAHDGVNYFMLPMEEIIFVGSN
Ga0315338_101650653300032138SeawaterMSNDDESIPEGDNEGVFDINEVLAEERLAEYLEEQIMEACNTGENYNVYPYASNSDLLNKTQNVDAAIISAFLSSYVKELGKQLKNALPSKCRLISGSGPAYFYNPTTKEFVKVERGTEVSVSPDMELDDLGRILAHDGVNYFMIPMEEIIFVGAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.