Basic Information | |
---|---|
Family ID | F087688 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 42 residues |
Representative Sequence | AEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.00 % |
% of genes near scaffold ends (potentially truncated) | 89.09 % |
% of genes from short scaffolds (< 2000 bps) | 80.00 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.909 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.818 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.54% β-sheet: 0.00% Coil/Unstructured: 72.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00378 | ECH_1 | 47.27 |
PF01144 | CoA_trans | 27.27 |
PF00285 | Citrate_synt | 1.82 |
PF09579 | Spore_YtfJ | 0.91 |
PF04909 | Amidohydro_2 | 0.91 |
PF00581 | Rhodanese | 0.91 |
PF00111 | Fer2 | 0.91 |
PF01694 | Rhomboid | 0.91 |
PF03745 | DUF309 | 0.91 |
PF02897 | Peptidase_S9_N | 0.91 |
PF00925 | GTP_cyclohydro2 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 27.27 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 27.27 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 27.27 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 1.82 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.91 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.91 |
COG1547 | Predicted metal-dependent hydrolase | Function unknown [S] | 0.91 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.91 % |
Unclassified | root | N/A | 9.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005174|Ga0066680_10197152 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300005445|Ga0070708_100165508 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300005538|Ga0070731_10453390 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300005540|Ga0066697_10566413 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300005542|Ga0070732_10040763 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
3300005559|Ga0066700_11086832 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005566|Ga0066693_10339898 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005574|Ga0066694_10156665 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300005602|Ga0070762_10865830 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005921|Ga0070766_10971973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 583 | Open in IMG/M |
3300005994|Ga0066789_10114124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1157 | Open in IMG/M |
3300006028|Ga0070717_10138301 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
3300006034|Ga0066656_10932374 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300006052|Ga0075029_100153749 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300006162|Ga0075030_101465560 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300006172|Ga0075018_10624650 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300006358|Ga0068871_100926847 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300006642|Ga0075521_10291792 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300006797|Ga0066659_10518467 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300006806|Ga0079220_10819851 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300006914|Ga0075436_100264347 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
3300009038|Ga0099829_10944552 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009520|Ga0116214_1030025 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
3300009521|Ga0116222_1252348 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300009522|Ga0116218_1153605 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300009643|Ga0116110_1217126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 617 | Open in IMG/M |
3300009700|Ga0116217_10768219 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300010335|Ga0134063_10121030 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300010343|Ga0074044_10995404 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300010359|Ga0126376_12182526 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300010359|Ga0126376_13120914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300010361|Ga0126378_11164329 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300010376|Ga0126381_100516028 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300012203|Ga0137399_11648143 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300012208|Ga0137376_10696775 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300012353|Ga0137367_10761272 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300012363|Ga0137390_11799599 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300012685|Ga0137397_10231977 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300012922|Ga0137394_11018345 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300012944|Ga0137410_10710430 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300014162|Ga0181538_10381353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 754 | Open in IMG/M |
3300014325|Ga0163163_10659962 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300014969|Ga0157376_11296639 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300015193|Ga0167668_1090175 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300015245|Ga0137409_10252137 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300015374|Ga0132255_101293945 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300015374|Ga0132255_104172950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300017657|Ga0134074_1260427 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300017930|Ga0187825_10243783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300017935|Ga0187848_10393862 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300017970|Ga0187783_10144274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1754 | Open in IMG/M |
3300017972|Ga0187781_10660862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 755 | Open in IMG/M |
3300018001|Ga0187815_10087889 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300018006|Ga0187804_10118962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1096 | Open in IMG/M |
3300018022|Ga0187864_10276035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 760 | Open in IMG/M |
3300018033|Ga0187867_10453883 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300018062|Ga0187784_10119381 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
3300018088|Ga0187771_11387676 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300018089|Ga0187774_10036055 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
3300018089|Ga0187774_10307192 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300018090|Ga0187770_10165176 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
3300018482|Ga0066669_11292623 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300019787|Ga0182031_1249826 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300019888|Ga0193751_1206600 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300020581|Ga0210399_11497500 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300020583|Ga0210401_11147992 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300021168|Ga0210406_10347425 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300021474|Ga0210390_10441155 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300021560|Ga0126371_11713323 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300022756|Ga0222622_11458575 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300025321|Ga0207656_10420144 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300025905|Ga0207685_10003417 | All Organisms → cellular organisms → Bacteria | 3857 | Open in IMG/M |
3300025939|Ga0207665_10429156 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300026315|Ga0209686_1139494 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300026326|Ga0209801_1249846 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300026330|Ga0209473_1010692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4553 | Open in IMG/M |
3300026331|Ga0209267_1212326 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300026343|Ga0209159_1056932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1880 | Open in IMG/M |
3300026528|Ga0209378_1107285 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300027869|Ga0209579_10220851 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300027884|Ga0209275_10634522 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300027911|Ga0209698_11285409 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300029636|Ga0222749_10723135 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031740|Ga0307468_100132900 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
3300031754|Ga0307475_11089651 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300031820|Ga0307473_10174314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1250 | Open in IMG/M |
3300031820|Ga0307473_11296169 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031833|Ga0310917_11162509 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031897|Ga0318520_10706770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300031954|Ga0306926_11455947 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300032042|Ga0318545_10186535 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300032160|Ga0311301_10303637 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
3300032805|Ga0335078_10141674 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
3300032805|Ga0335078_12115699 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300032898|Ga0335072_10011351 | All Organisms → cellular organisms → Bacteria | 12759 | Open in IMG/M |
3300032955|Ga0335076_10084147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3118 | Open in IMG/M |
3300033158|Ga0335077_10107165 | All Organisms → cellular organisms → Bacteria | 3270 | Open in IMG/M |
3300033158|Ga0335077_11002475 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300033809|Ga0314871_023116 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300033826|Ga0334847_002818 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.18% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.45% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.55% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.73% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.82% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.91% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.91% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033809 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_D | Environmental | Open in IMG/M |
3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066680_101971521 | 3300005174 | Soil | AEDKKLLLDIISSEKKWIAPKEGGRDPLATIAEPRKSAINL* |
Ga0070708_1001655081 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KDKEVLLDIIRNEKKWIKEKELARDPLSTIAEPRKSAINL* |
Ga0070731_104533902 | 3300005538 | Surface Soil | VMPSADDKKLLLEIIANENKWIAEKEGARDPFSTIGEPRKSAINL* |
Ga0066697_105664131 | 3300005540 | Soil | TPEDKTLLLDIIRNEKKWIVAKEGGRDPLATIGEPRKSAINL* |
Ga0070732_100407631 | 3300005542 | Surface Soil | LLEIIANDKKWIAEKEGARDPFATIGEPRKSAINL* |
Ga0066700_110868322 | 3300005559 | Soil | LDIIANEKKWIAEKEGARDPFETIAEPRKSAINL* |
Ga0066693_103398982 | 3300005566 | Soil | FEAMPSAEDKKLLLEIIANEKNWIAEKEGARDPFETIGEPRKSAINL* |
Ga0066694_101566651 | 3300005574 | Soil | AEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL* |
Ga0070762_108658301 | 3300005602 | Soil | ADDKKLLLELIANNKHWIAEKEGARDPFLTIGEPRKSAINL* |
Ga0070766_109719731 | 3300005921 | Soil | ELLLDIIRNEKKWIKEKEGARDPLTTITEPRKSAINI* |
Ga0066789_101141241 | 3300005994 | Soil | LLDIIGMEKKWIVAKEGGRDPLETIAEPRKSAINL* |
Ga0070717_101383014 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KLLLDIIANEKKWIAEKQGARDPFETIAEPRKSAINL* |
Ga0066656_109323741 | 3300006034 | Soil | YMPSAEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL* |
Ga0075029_1001537493 | 3300006052 | Watersheds | HLAECLPSAADKALLLDIIHNEKKWIKEKEGARDPFATIGEPRKSAINL* |
Ga0075030_1014655602 | 3300006162 | Watersheds | DKELLLDILRNEKKWIKEKEGARDPFATIGEPRRSAINL* |
Ga0075018_106246502 | 3300006172 | Watersheds | IIGAEKKWIAPRIGGRDPLATIGEVRKNAINAEK* |
Ga0068871_1009268471 | 3300006358 | Miscanthus Rhizosphere | DKKLLLELIGNEKGWIAEKEGARDPFLTIGEPRKSAINL* |
Ga0075521_102917921 | 3300006642 | Arctic Peat Soil | LLDIIRNEKKWIKEKEGARDPLSTIGEPRKSAINI* |
Ga0066659_105184672 | 3300006797 | Soil | EFLPSAEDKKLLLEIIANEKKWIAEKEGARDPFETIAEPRKSAINL* |
Ga0079220_108198512 | 3300006806 | Agricultural Soil | AADKQLLVDIIANEKQWIAEKTGARDPFETIGQPRKNAINL* |
Ga0075425_1030747792 | 3300006854 | Populus Rhizosphere | YAQQLDDFLPTAADKQLLVDIIANEKQWIAEKTGARDPFETIGQPRKNAINL* |
Ga0075436_1002643473 | 3300006914 | Populus Rhizosphere | PTAGDKKLLLEIIANEKKWIAEKEGARDPFETIAEPRKSAINI* |
Ga0099829_109445522 | 3300009038 | Vadose Zone Soil | KEYMPTAEDRKLLLDIINNEKKWIVSKEGGRDPLATIAEPRKSAINL* |
Ga0116214_10300255 | 3300009520 | Peatlands Soil | LLDIIRNEKKWIKEKEGARDPLSTIAEPRKSAINI* |
Ga0116222_12523482 | 3300009521 | Peatlands Soil | LKETLASEKKWITPRTGARDPFETIAEPRKMAINV* |
Ga0116218_11536051 | 3300009522 | Peatlands Soil | SADKKLLKETLASEKKWITPRTGARDPFETIAEPRKMAINV* |
Ga0116110_12171262 | 3300009643 | Peatland | ELLLDIIRNEKKWIKEKTGARDPLSTIEEPRKSAINL* |
Ga0105855_12043902 | 3300009649 | Permafrost Soil | MPNAADKKLLMDIIGSEKKWIAPLMGGRHALVTIGEVRKKAI |
Ga0116217_107682192 | 3300009700 | Peatlands Soil | LLLDIIRNEKKWIKEKEGARDPLSTIAEPRKSAINI* |
Ga0134063_101210302 | 3300010335 | Grasslands Soil | MPSAADKKLLLDIIGTEKKWIAPKEGARDPFETIAEPRKSAINL* |
Ga0134062_107714091 | 3300010337 | Grasslands Soil | EEHLKEYMPSAADKKLLLDIIGTEKKWIAPKEGARDPFETIAEPRKSAINL* |
Ga0074044_109954041 | 3300010343 | Bog Forest Soil | WLPTAADKKLLKETLANEKKWITPRTGARDPFETIAEPRKMAINVP* |
Ga0126376_121825262 | 3300010359 | Tropical Forest Soil | DKKLLLEIIANEKKWIVEKEGARDPFETIAEPRKSAINI* |
Ga0126376_131209142 | 3300010359 | Tropical Forest Soil | LEIIANEKKWITEKEGTRDPLETIGEPRKSAINL* |
Ga0126378_111643291 | 3300010361 | Tropical Forest Soil | EDKKLLLEIIANEKNWIAPKEGARDPFETIAEPRKSAINL* |
Ga0126378_122885951 | 3300010361 | Tropical Forest Soil | MPTAADKKLLLDIIGSEKKWIAPRNARDPLLTIGEVRKNAINAVQ* |
Ga0126381_1005160281 | 3300010376 | Tropical Forest Soil | EWLPNADDKKLLLEVIANEKNWIAPRVGVRDPFETIGQPRKSAINI* |
Ga0137399_116481431 | 3300012203 | Vadose Zone Soil | LLLDIIRNEKKWIKEKEGARDPLSTIGEPRKQAINI* |
Ga0137376_106967751 | 3300012208 | Vadose Zone Soil | KILLLDIIRNEKKWIVAKEGGRDPLATIAEPRKSAINL* |
Ga0137367_107612721 | 3300012353 | Vadose Zone Soil | VLLDILRNEKKWIKEKEGARDPLATIGEPRKSAVNL* |
Ga0137390_117995991 | 3300012363 | Vadose Zone Soil | LDIIRNEKKWIKEKEGARDPLSTIGEPRKQAINI* |
Ga0137397_102319773 | 3300012685 | Vadose Zone Soil | FGEVMPTAEDKSVLLEIIANEKKWIVEKEGARDPFQTIGEPRKSAINL* |
Ga0137394_110183452 | 3300012922 | Vadose Zone Soil | EDRKLLLEIIANEKKWIAEKEGARDPFQTIGEPRKSAINL* |
Ga0137410_107104302 | 3300012944 | Vadose Zone Soil | TAEDKKLLLETIANEKNWIAEKEGARDPFSTIGEPRKSAINL* |
Ga0134077_102282732 | 3300012972 | Grasslands Soil | EQHLSKYMPSAEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL* |
Ga0181538_103813531 | 3300014162 | Bog | LDIIRNEKKWIKEKTGARDPLSTIEEPRKSAINL* |
Ga0163163_106599621 | 3300014325 | Switchgrass Rhizosphere | EHLESVMPTADDKKLLLELIANEKGWIAEKEGARDPFLTIGEPRKSAINL* |
Ga0157376_112966391 | 3300014969 | Miscanthus Rhizosphere | TADDKKLLLELIANEKGWIAEKEGARDPFLTIGEPRKSAINL* |
Ga0167668_10901752 | 3300015193 | Glacier Forefield Soil | LDIIRNEKKWIKEKAGARDPLSTITEPRKSAINI* |
Ga0137409_102521373 | 3300015245 | Vadose Zone Soil | PHFHEVMPTAEDRKLLLEIIANEKKWIAEKEGARDPFQTIGEPRKSAINL* |
Ga0132255_1012939451 | 3300015374 | Arabidopsis Rhizosphere | LDIIANEKKWIKEKEGARDPLSSIGEPRKSAINL* |
Ga0132255_1041729501 | 3300015374 | Arabidopsis Rhizosphere | TAEDKKLLLELIAYEKKWIAEKEGARDPFETIGEPRKSAINL* |
Ga0134074_12604271 | 3300017657 | Grasslands Soil | AEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0187825_102437832 | 3300017930 | Freshwater Sediment | DKKLLLEIIASEKKWIAEKEGARDPFATIGEPRRSAINL |
Ga0187848_103938622 | 3300017935 | Peatland | QDKALLLDIIRNEKKWIKGKEGARDPFATIAEPRRSAINL |
Ga0187783_101442741 | 3300017970 | Tropical Peatland | LLKETLATEKKWITPRTGARDPFETIAEPRKAAINVP |
Ga0187781_106608622 | 3300017972 | Tropical Peatland | LPSAKDKELLLDIIRNEKKWIKEKTGARDPFSTIAEPRKSAINL |
Ga0187815_100878893 | 3300018001 | Freshwater Sediment | LKETLANEKKWITPRTGARDPFETIAEPRKAAINVP |
Ga0187804_101189623 | 3300018006 | Freshwater Sediment | LLDIIRNEKKWIKEKEGARDPLSTIGEPRKSAVNL |
Ga0187864_102760351 | 3300018022 | Peatland | LLLDIIRNEKKWIKEKTGARDPLSTIEEPRKSAINL |
Ga0187867_104538832 | 3300018033 | Peatland | VREVLPGLDDRKLLLDTLSTEKKWIVAKEGGRDPLATISEPRRSAINL |
Ga0187784_101193814 | 3300018062 | Tropical Peatland | TAADKKLLKETLATEKKWITPRTGARDPFETIAEPRKAAINI |
Ga0187771_113876761 | 3300018088 | Tropical Peatland | PTAADKKLLKETIASEKKWITPRTGARDPFETIAEPRKAAINVP |
Ga0187774_100360551 | 3300018089 | Tropical Peatland | AEDKKHLLDLITNEKRWIAGKQGARDPFATIGEPRRSAINL |
Ga0187774_103071921 | 3300018089 | Tropical Peatland | YDRQVSEWLPTAADKKLLKETLANEKKWITPRTGARDPFETIAEPRRAAINV |
Ga0187770_101651763 | 3300018090 | Tropical Peatland | KLLKETLATEKKWITPRTGARDPFETIAEPRKAAINI |
Ga0066669_110167112 | 3300018482 | Grasslands Soil | EQHLSKYMPSAEDRRLLLAIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0066669_112926231 | 3300018482 | Grasslands Soil | FLPSAEDKKLLLEIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0182031_12498261 | 3300019787 | Bog | QQHCQENLPGAKDKELLLDIIRNEKKWIKEREEGARDPLSTISEPRKSAINI |
Ga0193751_12066001 | 3300019888 | Soil | ALLLDIIRNEKKWIKEKTGARDPLSTMGEPRKSAINI |
Ga0210399_114975002 | 3300020581 | Soil | LLLETIANEKHWIAEKEGARDPFLTIGEPRKSAINL |
Ga0210401_111479922 | 3300020583 | Soil | ELLLDIIRNEKKWIKEKAGARDPLSTISEPRKSAINL |
Ga0210406_103474253 | 3300021168 | Soil | LLLDIIRNEKKWIKEKEGARDPLSTIGEPRKQAINI |
Ga0210390_104411552 | 3300021474 | Soil | HFQEVMPSADDKKLLLEIIANENKWITEKEGARDPFSTIGEPRKSAINL |
Ga0210398_109615981 | 3300021477 | Soil | DQHLAEVLPSADDKKLLLELIANNKHWIAEKEGARDPFLTIGEPRKSAINL |
Ga0126371_117133232 | 3300021560 | Tropical Forest Soil | QFLPTAEDKKRLLEIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0222622_114585752 | 3300022756 | Groundwater Sediment | MPTAEDKTLLLDIIRNEKRWIVAKEGGRDPLATISEPRKSAINL |
Ga0207656_104201442 | 3300025321 | Corn Rhizosphere | LLLDIIASEPSWIVPKIGARDPFETITEPRRSAINL |
Ga0207685_100034171 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTAEDKKLLLEIIANEKNWIAEKEGARDPFATIGEPRKSAINL |
Ga0207665_104291561 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LLDIIRNEKKWIVAKEGGRDPLATIGEPRKSAINL |
Ga0209686_11394941 | 3300026315 | Soil | EYMPTPEDKTLLLDIIRNEKKWIVAKEGGRDPLATIGEPRKSAINL |
Ga0209801_12498462 | 3300026326 | Soil | YMPSAADKKLLLDIIGTEKKWIAPKEGARDPFETIAEPRKSAINL |
Ga0209473_10106922 | 3300026330 | Soil | LKDYMPSAEDKKLLLDIIANEKRWIAAKEGARDPFETIAEPRKSAINL |
Ga0209267_12123262 | 3300026331 | Soil | QHLSEYMPSAEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0209159_10569323 | 3300026343 | Soil | DKKLLLDIIGTEKKWIAPKEGARDPFETIAEPRKSAINL |
Ga0209378_11072853 | 3300026528 | Soil | KYMPSAEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0209474_102184841 | 3300026550 | Soil | EQHLSEYMPSAEDKKLLLDIIANEKKWIAEKEGARDPFETIAEPRKSAINL |
Ga0209579_102208512 | 3300027869 | Surface Soil | VMPSADDKKLLLEIIANENKWIAEKEGARDPFSTIGEPRKSAINL |
Ga0209275_106345221 | 3300027884 | Soil | ADDKKLLLELIANNKHWIAEKEGARDPFLTIGEPRKSAINL |
Ga0209698_112854092 | 3300027911 | Watersheds | KDKELLLDILRNEKKWIKEKEGARDPFATIGEPRRSAINL |
Ga0222749_107231352 | 3300029636 | Soil | TAEDKKLLLEIIANDKKWVAEKEGTRDPFATIGEPRKSAINL |
Ga0307468_1001329003 | 3300031740 | Hardwood Forest Soil | KKLLLEIIVNEKKWIAEKEGARDPFATIGEPRKSAINL |
Ga0307475_110896511 | 3300031754 | Hardwood Forest Soil | EDKKLLLEIIANEKRWIAEKEGARDPFETIGEPRKSAINL |
Ga0307473_101743141 | 3300031820 | Hardwood Forest Soil | TLLLDIIRNEEKWIVAKEGGRDPLATISEPRKSAINL |
Ga0307473_112961692 | 3300031820 | Hardwood Forest Soil | QLEIIANEKKWIAEKEGARDPFATIGEPRKSAINL |
Ga0310917_111625092 | 3300031833 | Soil | LLLELIANEKHWIAEKEGARDPFLTIGEPRKSAINL |
Ga0318520_107067702 | 3300031897 | Soil | KLLLEIIANEKKWIAEKEGSRDPFATIGEPRKSAINL |
Ga0306926_114559471 | 3300031954 | Soil | LLLEIILNEKNWIVAKENARDPLATIAEPRKSAINL |
Ga0318545_101865352 | 3300032042 | Soil | HFAEAMPTAEDKKLLLEIIANEKKWIAEKEGSRDPFATIGEPRKSAINL |
Ga0311301_103036375 | 3300032160 | Peatlands Soil | AGEWLPTAADKKLLKETLANEKKWITPRTGARDPFETIAEPRKMAINV |
Ga0307471_1042393122 | 3300032180 | Hardwood Forest Soil | EEHLKEYMPSAADKKLLLDIIGTEKKWIAPKEGARDPFETIAEPRKSAINL |
Ga0335079_103895731 | 3300032783 | Soil | RAYREHTAECLPSAADKAHLLDIIRNEKSWIKEKEGARDPFATIGEPRRSAINL |
Ga0335078_101416744 | 3300032805 | Soil | EVLPSAKDKASLLDVLRNEKKWIKEKQGARDPFATIGEPRRSAINL |
Ga0335078_121156992 | 3300032805 | Soil | RLLPTAEDKKLLLEIIANEKQWIAPKVGARDPFETIGEPRKSAINL |
Ga0335072_1001135114 | 3300032898 | Soil | VLPSAKDKALLLDVLRNEKKWIKEKEGARDPFATIGEPRRSAINL |
Ga0335076_100841471 | 3300032955 | Soil | DKALLLDVLRNEKKWIKEKEGARDPFATIGEPRRSAINL |
Ga0335077_101071655 | 3300033158 | Soil | EDKAYERQVSEWLPTAADKKLLKETLATEKKWITPRTGARDPFETIAEPRKGAINVS |
Ga0335077_110024751 | 3300033158 | Soil | LKEALPTAADKQLLLDIISTEKKWIAEKEGARDPFETIGEPRKSAINL |
Ga0314871_023116_410_529 | 3300033809 | Peatland | DKKLLLEIIANEKKWIAEKEGARDPFATIGEPRKSAINL |
Ga0334847_002818_2_112 | 3300033826 | Soil | LLLDIIRNEKKWIKEKEGARDPLATIGEPRKSAINI |
⦗Top⦘ |