 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F087592 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQ |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 51.43 % |
| % of genes near scaffold ends (potentially truncated) | 93.64 % |
| % of genes from short scaffolds (< 2000 bps) | 86.36 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.909 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.636 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 89.09 |
| PF13801 | Metal_resist | 7.27 |
| PF00664 | ABC_membrane | 1.82 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF05635 | 23S_rRNA_IVP | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.91 % |
| All Organisms | root | All Organisms | 19.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.64% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.36% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.73% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.82% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.91% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.91% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.91% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004470 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031044 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10491201 | 3300001154 | Forest Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIALRPARHGIESQG |
| JGI12635J15846_101347824 | 3300001593 | Forest Soil | MKSLFLRIFLSFWAAQALFLVLAILVTIAMRPARH |
| JGIcombinedJ26739_1008427691 | 3300002245 | Forest Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESEGPQILAEV |
| Ga0062387_1011951252 | 3300004091 | Bog Forest Soil | MKSLFLRIFLSFWAALALSLVLAILVTIALRPARRGIESQGL |
| Ga0062389_1004957621 | 3300004092 | Bog Forest Soil | MKSLFLKIFLSFWAAQALFVVLAILATIALSPTRHGIESES |
| Ga0068967_12534222 | 3300004470 | Peatlands Soil | MRSLFLKIFLSFLAALALSLVLAILVTIALRPKRHGIENEAPQTLAEAVNAY |
| Ga0066661_105122441 | 3300005554 | Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIAMRPARHGIESQGPQ |
| Ga0075029_1005622652 | 3300006052 | Watersheds | MKSLFLRIFLSFWVAQALFLVLAILVTIAMRPTRHGIE |
| Ga0075017_1007250092 | 3300006059 | Watersheds | MKSLFLKIFLSFWAAQALFVVLAILVTIALRPARH |
| Ga0075017_1011999271 | 3300006059 | Watersheds | MKSLFLKIFLSFWVAQALFIVLAILVTIALSPARHGIESESPQVLAEAVNAYQ |
| Ga0075014_1009315122 | 3300006174 | Watersheds | MKSLFLKIFLSFWVAQALFIVLAILVTIALSPARHGIESESPQVLAEA |
| Ga0068871_1001210824 | 3300006358 | Miscanthus Rhizosphere | MRLFLRIFLSFWLAQALFLVLAILVTIVMRPTRRI |
| Ga0066665_112641011 | 3300006796 | Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIAMRPARHGIESQGPQIL |
| Ga0099793_103147782 | 3300007258 | Vadose Zone Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIALRPARHGIESQGPQIL |
| Ga0066793_104794841 | 3300009029 | Prmafrost Soil | MKSLFLKIFLSFWAAQAMFLELAILVMIALRPARPGLESQ |
| Ga0099829_109388651 | 3300009038 | Vadose Zone Soil | MRSLFLKIFLSFWAAQALFLVLAILLVIALRATREPGI |
| Ga0099827_103909811 | 3300009090 | Vadose Zone Soil | MRSLFLKIFLSFWAAQALFLVLAILVFIGLRHNREPGIESLGGRVI |
| Ga0105240_101647865 | 3300009093 | Corn Rhizosphere | MRSLFLKIFLSYWLALALFMVFAILVTLAIRPPRE |
| Ga0099792_110541742 | 3300009143 | Vadose Zone Soil | MKSLFLKIFLSFWAAQALFLVLAILATIALRPARH |
| Ga0116222_12672812 | 3300009521 | Peatlands Soil | MKSLFLKIFVSFWAVLALSLVLAIVVTIALRPERRGIESQAPQTL |
| Ga0116225_10745733 | 3300009524 | Peatlands Soil | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIESQG |
| Ga0116113_11140781 | 3300009638 | Peatland | MKSLFVRIFLSFWAAQALFIVLAILVTIAMRPARRG |
| Ga0116132_11903111 | 3300009646 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIAVRPARHGIESEGPQILAEAVNAYQ |
| Ga0116135_10027601 | 3300009665 | Peatland | VRSLFLRIFLSFWAAQALLVVLAILLTMAFRPRNAT |
| Ga0074046_108854742 | 3300010339 | Bog Forest Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPTRHGVESEGPQILAEIV |
| Ga0074045_101174541 | 3300010341 | Bog Forest Soil | MKSLFLKIFLSLWAALALSMVLAILVTIALRPPRHAMESQAPQILAEVVN |
| Ga0074045_108863752 | 3300010341 | Bog Forest Soil | MKSLFLKIFLSFWAAQALFLVLAILVTMALRPARHGIESEAPQILAEAVNAYQ |
| Ga0126370_101903091 | 3300010358 | Tropical Forest Soil | MRSLFLRIFLSFWAAQGIFIVLAILVTIARTPGRQERMEGLGAQAL |
| Ga0138581_10380702 | 3300011085 | Peatlands Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIE |
| Ga0137388_110954321 | 3300012189 | Vadose Zone Soil | MRSLFLKIFLSFWAAQALFLVLAILVVIALRPTREPGIESLGARVITEAVGA |
| Ga0137362_101313691 | 3300012205 | Vadose Zone Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQ |
| Ga0137395_109091652 | 3300012917 | Vadose Zone Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIAMRPARHG |
| Ga0137394_104198793 | 3300012922 | Vadose Zone Soil | MRSLFLKIFLSFWAAQALFLVLAILVVIALRPTREPGIES |
| Ga0137359_107050052 | 3300012923 | Vadose Zone Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIALRPARHGIESQGP |
| Ga0126369_112734382 | 3300012971 | Tropical Forest Soil | MKSLFLRIFLSFWAAQALFLVLAILVTIAIRPRHGVENL |
| Ga0163163_100644524 | 3300014325 | Switchgrass Rhizosphere | MRLFLRIFLSFWLAQALFLVLAILVTIVMRPTRRIS* |
| Ga0181536_103411741 | 3300014638 | Bog | MMKSLFLKIFLSFWAAQALFLVLAILVTIALQPARHGIEAEGPQILAEV |
| Ga0182027_112981942 | 3300014839 | Fen | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQGSEILAE |
| Ga0167668_10779272 | 3300015193 | Glacier Forefield Soil | MKSLFLKIFLSFWAAQALFLVVAILVTIAMRPARRGMESEGAQILA |
| Ga0181511_11593672 | 3300016702 | Peatland | MKSLFLKIFLSFWVAQALFLVLAILVMLAFRPQRNST |
| Ga0187856_10724211 | 3300017925 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIAVRPARH |
| Ga0187856_12568281 | 3300017925 | Peatland | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARR |
| Ga0187806_13720141 | 3300017928 | Freshwater Sediment | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQGPQILAE |
| Ga0187849_13626052 | 3300017929 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHG |
| Ga0187854_100411081 | 3300017938 | Peatland | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARH |
| Ga0187819_105281521 | 3300017943 | Freshwater Sediment | MKSLFLKIFLSLWAALALSMVLAILVTIALRPPRHEM |
| Ga0187847_102078241 | 3300017948 | Peatland | MKSLFLKIFLSFWIAQALFVVLAILATIALSPRRHGIESEGPQILAEVVNAYQS |
| Ga0187817_111230102 | 3300017955 | Freshwater Sediment | MKSLFLRIFLSFWAVLALFLVLAILVTIAMRPARDGIENT |
| Ga0187782_113933541 | 3300017975 | Tropical Peatland | MKSLFLRIFLSFWAACALFLVLAILVTIAMNPSRRGIASQGPE |
| Ga0181520_102740102 | 3300017988 | Bog | MKSLFLKIFISFWAALALSLVLAIMVTIALRPARRGIESQAPQTLAE |
| Ga0187816_101190201 | 3300017995 | Freshwater Sediment | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIESQGLQ |
| Ga0187816_103853442 | 3300017995 | Freshwater Sediment | MKSLFLKIFLSLWAALALSMVLAILVTIALRPPRHAMESQAPQILAEV |
| Ga0187891_11888202 | 3300017996 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIAVRPARHGIES |
| Ga0187884_102386491 | 3300018009 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIAVRPARHG |
| Ga0187880_10517821 | 3300018016 | Peatland | MKSLFLKIFLSFWAALALSLVLAIVVTIALRPTRHGIEN |
| Ga0187889_103115052 | 3300018023 | Peatland | MKSLFLKIFLSFWAALALSSVLAIVVTIALRPTRHGIENQAPQTLA |
| Ga0187855_101109613 | 3300018038 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIALSPRRGIESQ |
| Ga0187871_103683461 | 3300018042 | Peatland | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIE |
| Ga0187871_108117402 | 3300018042 | Peatland | MKSLFLKIFLSFWAAQVLFVVLAILVTIALRPTRHGIE |
| Ga0187887_103394131 | 3300018043 | Peatland | MKSLFLKIFLSFWAALALSLVLAIVVTIALRPTRRGIESQAPQA |
| Ga0187851_100606224 | 3300018046 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIALSPRRGIESQGPQILAEVVN |
| Ga0187772_100743711 | 3300018085 | Tropical Peatland | MKSLFLRIFFSFWAAQALFIVLAILVTIATRPARRDI |
| Ga0187772_114192951 | 3300018085 | Tropical Peatland | MKSLFLKIFLSFWAAQALFLVLAILATIALNPRHGIETQAPQILAET |
| Ga0182031_12189905 | 3300019787 | Bog | MKSLFLKIFLSFWAAQALFLVLAILVTIASARRGTASR |
| Ga0193734_10411212 | 3300020015 | Soil | MRSLFLKIFLSFWVAQALFLVLAVLVTLAIRQQAE |
| Ga0210401_114145062 | 3300020583 | Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIAMRPARHGIE |
| Ga0210387_111662121 | 3300021405 | Soil | MKSLFLKIFLSFWIAQALFVVLAILVTIALSPTRHGIESEGPQILAEI |
| Ga0210391_114671001 | 3300021433 | Soil | MKSLFLKIFLSFWAALALSLVLAILVTIALQPPRRGIASQG |
| Ga0210392_114989921 | 3300021475 | Soil | MKSLFLRIFLSFWAAQALFLVLAILATIAMRPTRHGIEN |
| Ga0208036_10366662 | 3300025419 | Peatland | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIESQGLQTLAEAVN |
| Ga0208036_10709592 | 3300025419 | Peatland | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARRGI |
| Ga0208937_10221211 | 3300025506 | Peatland | MKSLFLKIFLSFWAAQALFLVLAILVTIAVRPARHGIESEGPQILA |
| Ga0208188_11120801 | 3300025507 | Peatland | MTRWPDDPIIMKSLFLKIFLSFWAALALSLVLAIVVTIALRPTRHGIENQAPQTLAEAV |
| Ga0257165_10411091 | 3300026507 | Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQGSQI |
| Ga0209421_10103553 | 3300027432 | Forest Soil | MKSLFLRIFLSFWAALVLFIILSILVAIAVNPARGIESQEPEILAEAVNAYQS |
| Ga0209735_10771062 | 3300027562 | Forest Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIAVRPARHGIESQA |
| Ga0209219_10397431 | 3300027565 | Forest Soil | MRSLFLRIFLSFWAAQALFLVLAILVTIAMRPARHGIESQGPQILAEAVNA |
| Ga0208044_10111535 | 3300027625 | Peatlands Soil | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIESQGL |
| Ga0209420_10405393 | 3300027648 | Forest Soil | MKSLFLKIFLSFWAVLALSLILAILVTIALGPTRHGIENQGPQTLAEAVNAYE |
| Ga0208991_11700742 | 3300027681 | Forest Soil | MRSLFLKIFLSFWAAQALFLVLAILVVIALRPTRE |
| Ga0209180_102337762 | 3300027846 | Vadose Zone Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQGSQILA |
| Ga0209517_106054532 | 3300027854 | Peatlands Soil | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIESE |
| Ga0209068_103259201 | 3300027894 | Watersheds | MKSLFLRIFLSFWAAQALFVVLAILVTIAMRPLRHGME |
| Ga0209698_111157592 | 3300027911 | Watersheds | MKSLFLKIFLTFWAAQVLFVVLAILVTIALSPARHGIESESPQILAE |
| Ga0137415_106990801 | 3300028536 | Vadose Zone Soil | MRSLFLKIFLSFWAAQALFLVLAILVVIALRPTREPGIESMGSRVIT |
| Ga0302162_100562771 | 3300028649 | Fen | MKSLFLRIFLSFWAAQALFIVLAILVTIAMSPPRRGIENRS |
| Ga0302222_104521971 | 3300028798 | Palsa | MKSLFLKIFLSFWAALALSLVLAILVTIAMRPARRGIESQGLQTLAEAVN |
| Ga0302155_105247042 | 3300028874 | Bog | MKSLFLKIFLSFWIAQALFVVLAILATIALSPRRQGIESEGPQILA |
| Ga0311327_105153191 | 3300029883 | Bog | MKSLFLKIFLSFWIAQALFVVLAILATIALSPRRQGIESEGPQILAEVVNAYQ |
| Ga0311340_101456721 | 3300029943 | Palsa | MKSLFLKIFLSFWAALALSLVLAILVTIAMRPARRGIESQGL |
| Ga0311355_105382961 | 3300030580 | Palsa | MKSLFLKIFLSFWAVLALSLILAILVTIALGPTRH |
| Ga0311356_109983391 | 3300030617 | Palsa | MKSLFLKIFLSFWAVLALSLILAILVTIALGPTRHGIE |
| Ga0310039_101003983 | 3300030706 | Peatlands Soil | MKSLFLKIFLSFWAALALSLVLAILVTIALRPARHGIESQGLQTLAE |
| Ga0265767_1044831 | 3300030836 | Soil | MRSLFLKIFLSFWVALALFLVIAILLTLAFRPRSATW |
| Ga0265765_10232962 | 3300030879 | Soil | MRTLFLKIFLSFWAALALFLVLAILVMLAFRPQRNS |
| Ga0265747_1030041 | 3300031044 | Soil | MRSLFLKIFLSFWVALALFLVIAILLTLAFRPRSATWEA |
| Ga0170834_1017526672 | 3300031057 | Forest Soil | MKSLFLKIFLSFWAAQALFLVLAILVTIALRPARHGIESQGSQILAEAVNAYQGG |
| Ga0302307_103220801 | 3300031233 | Palsa | MKSLFLKIFLTFWAAQALFVVLAILVTIALRPTRHGIESEGPQILAEVVNAYQSG |
| Ga0302325_107784791 | 3300031234 | Palsa | MKSLFLKIFLSFWAVLALSLILAILVTIALGPTRHGIENQGPQILAEAVNAYE |
| Ga0307476_113012482 | 3300031715 | Hardwood Forest Soil | MRSLFLKIFLWFWAALALSLVLAILVTISLRPTRHGVENQAPQTLAEAV |
| Ga0307473_101664753 | 3300031820 | Hardwood Forest Soil | MRSLFLKIFLSFWAAQALFLVLAILVVIALRPTREPGIESMGARVITEAVG |
| Ga0307479_117202412 | 3300031962 | Hardwood Forest Soil | MRSLFLRIFLSFWAAQALFLVLAILATIAMRPARHGIESQGPQILAEA |
| Ga0307471_1007271573 | 3300032180 | Hardwood Forest Soil | MRSLFLKIFLSYWLAFALFLVLAILVTLAIRPPRET |
| Ga0307472_1006975661 | 3300032205 | Hardwood Forest Soil | MKSLFLRIFLSFWAAQALFLVLAILATIALRPARHGLESEGPQILAEAV |
| Ga0307472_1027310771 | 3300032205 | Hardwood Forest Soil | MKSLFWRIFLSFWIAQALFLVLAILVTIVFRPRSS |
| Ga0306920_1028442152 | 3300032261 | Soil | MRSLFLKIFLSFWAAQALFIVLAILVTIAMWPGRQSRVAN |
| Ga0335070_107690911 | 3300032829 | Soil | MRSLFLKIFFSFWGAQALFLVLAILVTLAMRPTREPGLETL |
| Ga0335071_106217472 | 3300032897 | Soil | MKSLFLKIFLSFWAAQALFVVLAMIAAIAFRPQTEAPH |
| Ga0335076_104353301 | 3300032955 | Soil | VSFWAAQALFIILAILVTIALNPARHGVESRAPEWLAEAVN |
| Ga0335084_106806772 | 3300033004 | Soil | MKSLFLRIFFSFWIAFALFVVLAILVTIAFRPRTSTWEA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |