NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087567

Metagenome / Metatranscriptome Family F087567

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087567
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 43 residues
Representative Sequence MATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Number of Associated Samples 95
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 48.18 %
% of genes from short scaffolds (< 2000 bps) 90.91 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.273 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.273 % of family members)
Environment Ontology (ENVO) Unclassified
(28.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF10503Esterase_PHB 4.55
PF00884Sulfatase 2.73
PF12244DUF3606 2.73
PF13545HTH_Crp_2 1.82
PF00011HSP20 1.82
PF00239Resolvase 1.82
PF00872Transposase_mut 1.82
PF11306DUF3108 0.91
PF07536HWE_HK 0.91
PF00166Cpn10 0.91
PF00916Sulfate_transp 0.91
PF06078DUF937 0.91
PF01346FKBP_N 0.91
PF04392ABC_sub_bind 0.91
PF13546DDE_5 0.91
PF00912Transgly 0.91
PF01548DEDD_Tnp_IS110 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 1.82
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 1.82
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 1.82
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 1.82
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.91
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.91
COG4251Bacteriophytochrome (light-regulated signal transduction histidine kinase)Signal transduction mechanisms [T] 0.91
COG3920Two-component sensor histidine kinase, HisKA and HATPase domainsSignal transduction mechanisms [T] 0.91
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.91
COG3547TransposaseMobilome: prophages, transposons [X] 0.91
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.91
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 0.91
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 0.91
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.91
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 0.91
COG0545FKBP-type peptidyl-prolyl cis-trans isomerasePosttranslational modification, protein turnover, chaperones [O] 0.91
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.27 %
UnclassifiedrootN/A42.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig567402Not Available558Open in IMG/M
2166559005|cont_contig101682Not Available567Open in IMG/M
2170459002|F0B48LX02GJN3ZNot Available540Open in IMG/M
2170459003|FZ032L002HBB3YNot Available514Open in IMG/M
3300000156|NODE_c0732167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8401Open in IMG/M
3300001545|JGI12630J15595_10086625Not Available615Open in IMG/M
3300001867|JGI12627J18819_10085944Not Available1304Open in IMG/M
3300002245|JGIcombinedJ26739_100229107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1749Open in IMG/M
3300002245|JGIcombinedJ26739_100339146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1385Open in IMG/M
3300002906|JGI25614J43888_10004851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4294Open in IMG/M
3300004114|Ga0062593_100830484Not Available924Open in IMG/M
3300004463|Ga0063356_106066107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7518Open in IMG/M
3300004480|Ga0062592_101036732Not Available753Open in IMG/M
3300005146|Ga0066817_1003864All Organisms → cellular organisms → Bacteria → Proteobacteria986Open in IMG/M
3300005147|Ga0066821_1003157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium934Open in IMG/M
3300005180|Ga0066685_10968893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300005356|Ga0070674_100088630Not Available2227Open in IMG/M
3300005434|Ga0070709_10260114All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300005436|Ga0070713_100928591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria838Open in IMG/M
3300005440|Ga0070705_101083441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300005445|Ga0070708_100113134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2496Open in IMG/M
3300005467|Ga0070706_100771541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria890Open in IMG/M
3300005545|Ga0070695_101767892Not Available518Open in IMG/M
3300005564|Ga0070664_101785355Not Available583Open in IMG/M
3300005615|Ga0070702_101184978All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300005718|Ga0068866_10627890Not Available729Open in IMG/M
3300005841|Ga0068863_100620198Not Available1071Open in IMG/M
3300006028|Ga0070717_10677596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria936Open in IMG/M
3300006028|Ga0070717_12160557Not Available500Open in IMG/M
3300006038|Ga0075365_10201736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1393Open in IMG/M
3300006038|Ga0075365_10731839Not Available699Open in IMG/M
3300006049|Ga0075417_10447508Not Available644Open in IMG/M
3300006175|Ga0070712_100393933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1142Open in IMG/M
3300006576|Ga0074047_11902926All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300006794|Ga0066658_10798972Not Available532Open in IMG/M
3300006844|Ga0075428_100389211All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300006904|Ga0075424_100755815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1037Open in IMG/M
3300009100|Ga0075418_10533645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1261Open in IMG/M
3300009100|Ga0075418_11036488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria888Open in IMG/M
3300009100|Ga0075418_12207912Not Available600Open in IMG/M
3300009143|Ga0099792_10914415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300009147|Ga0114129_12764594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300009176|Ga0105242_12786341Not Available539Open in IMG/M
3300009551|Ga0105238_11763819All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300009840|Ga0126313_10604627Not Available884Open in IMG/M
3300010373|Ga0134128_11053751Not Available898Open in IMG/M
3300010399|Ga0134127_10356322All Organisms → cellular organisms → Bacteria → Proteobacteria1431Open in IMG/M
3300010403|Ga0134123_13649143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7500Open in IMG/M
3300011120|Ga0150983_12539512Not Available538Open in IMG/M
3300012022|Ga0120191_10160235Not Available521Open in IMG/M
3300012189|Ga0137388_10015339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5591Open in IMG/M
3300012205|Ga0137362_11184881Not Available648Open in IMG/M
3300012285|Ga0137370_10967536Not Available525Open in IMG/M
3300012906|Ga0157295_10039860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1067Open in IMG/M
3300012923|Ga0137359_10101206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2545Open in IMG/M
3300012941|Ga0162652_100068481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300012951|Ga0164300_10028851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2015Open in IMG/M
3300012955|Ga0164298_10356152Not Available929Open in IMG/M
3300012955|Ga0164298_10640611All Organisms → cellular organisms → Bacteria → Proteobacteria736Open in IMG/M
3300012955|Ga0164298_10973391All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012984|Ga0164309_10096580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1854Open in IMG/M
3300012985|Ga0164308_10761505Not Available841Open in IMG/M
3300012985|Ga0164308_12181685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → Dongia mobilis516Open in IMG/M
3300012988|Ga0164306_12023950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300013297|Ga0157378_10530740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1180Open in IMG/M
3300013306|Ga0163162_10953858Not Available969Open in IMG/M
3300015077|Ga0173483_10755985All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300015371|Ga0132258_10051700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria9405Open in IMG/M
3300015374|Ga0132255_100730129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1473Open in IMG/M
3300015374|Ga0132255_101156982Not Available1164Open in IMG/M
3300015374|Ga0132255_101319919Not Available1088Open in IMG/M
3300016387|Ga0182040_11676018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300016422|Ga0182039_10795153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium839Open in IMG/M
3300018028|Ga0184608_10054716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1581Open in IMG/M
3300018031|Ga0184634_10338598Not Available690Open in IMG/M
3300018053|Ga0184626_10400788All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300018054|Ga0184621_10038991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1550Open in IMG/M
3300018081|Ga0184625_10196007Not Available1058Open in IMG/M
3300018476|Ga0190274_10981109All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300018476|Ga0190274_11767442Not Available713Open in IMG/M
3300019263|Ga0184647_1065848Not Available561Open in IMG/M
3300019361|Ga0173482_10106562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1027Open in IMG/M
3300019361|Ga0173482_10171282Not Available865Open in IMG/M
3300020016|Ga0193696_1037597All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300020199|Ga0179592_10299189Not Available715Open in IMG/M
3300020581|Ga0210399_10593833Not Available916Open in IMG/M
3300021168|Ga0210406_10155740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1915Open in IMG/M
3300021478|Ga0210402_10548138Not Available1073Open in IMG/M
3300025915|Ga0207693_10738448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7761Open in IMG/M
3300025929|Ga0207664_10421828Not Available1188Open in IMG/M
3300025931|Ga0207644_10195660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1592Open in IMG/M
3300025931|Ga0207644_10341872Not Available1214Open in IMG/M
3300025938|Ga0207704_10288345All Organisms → cellular organisms → Bacteria → Proteobacteria1251Open in IMG/M
3300026693|Ga0208709_104965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300027603|Ga0209331_1032972Not Available1331Open in IMG/M
3300027635|Ga0209625_1124446Not Available578Open in IMG/M
3300027655|Ga0209388_1106930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium801Open in IMG/M
3300027873|Ga0209814_10533240Not Available521Open in IMG/M
3300027909|Ga0209382_10073807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4029Open in IMG/M
3300027909|Ga0209382_11603847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 190643Open in IMG/M
3300028047|Ga0209526_10575677Not Available724Open in IMG/M
3300028047|Ga0209526_10681030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria650Open in IMG/M
3300028768|Ga0307280_10420247Not Available501Open in IMG/M
3300028784|Ga0307282_10209286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales933Open in IMG/M
3300028787|Ga0307323_10275269Not Available606Open in IMG/M
3300028875|Ga0307289_10271723Not Available697Open in IMG/M
3300031720|Ga0307469_10224957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1487Open in IMG/M
3300031740|Ga0307468_100323862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga1134Open in IMG/M
3300032174|Ga0307470_10026505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2698Open in IMG/M
3300032180|Ga0307471_103917060All Organisms → cellular organisms → Bacteria526Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.09%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.64%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.91%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.91%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.91%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005146Soil and rhizosphere microbial communities from Laval, Canada - mgHABEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026693Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN595 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_054667402124908045SoilMATKEHKPFGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK
cont_0681.000061102166559005SimulatedMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRT
E1_046504502170459002Grass SoilMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEINVR
E4A_087478402170459003Grass SoilMATKEYNPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK
NODE_0732167113300000156Sugar Cane Bagasse Incubating BioreactorMVTKEYRPLGPKASKAIKFTDWLVEVAYVCESCGTEIKRTIREK*
JGI12630J15595_1008662513300001545Forest SoilMATKEYXPMEPKARKAIKFTDSLVEVVYLCESCGTEIKRTIREN*
JGI12627J18819_1008594413300001867Forest SoilMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTETKRTIREK*
JGIcombinedJ26739_10022910723300002245Forest SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREN*
JGIcombinedJ26739_10033914633300002245Forest SoilMATKEHKPMGPEQCKAIRFTDSLVEVAYVCESCGTEIKRTIRK*
JGI25614J43888_1000485153300002906Grasslands SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET*
Ga0062593_10083048413300004114SoilMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTIREN*
Ga0063356_10606610723300004463Arabidopsis Thaliana RhizosphereMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0062592_10103673223300004480SoilMATKEHKPMEPKARKAIKFSDSLVEVVYICESCGTEIKRTIREK*
Ga0066817_100386423300005146SoilMATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0066821_100315733300005147SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK*
Ga0066685_1096889313300005180SoilKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK*
Ga0070674_10008863033300005356Miscanthus RhizosphereMATKEHKPLGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0070709_1026011423300005434Corn, Switchgrass And Miscanthus RhizosphereMATKEYSPTEPKARKAVKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0070713_10092859133300005436Corn, Switchgrass And Miscanthus RhizosphereRMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIRK*
Ga0070705_10108344113300005440Corn, Switchgrass And Miscanthus RhizosphereMATKEYNPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0070708_10011313463300005445Corn, Switchgrass And Miscanthus RhizosphereMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0070706_10077154113300005467Corn, Switchgrass And Miscanthus RhizosphereMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIRK*
Ga0070695_10176789213300005545Corn, Switchgrass And Miscanthus RhizosphereMATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0070664_10178535523300005564Corn RhizosphereMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGT
Ga0070702_10118497813300005615Corn, Switchgrass And Miscanthus RhizosphereMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRT
Ga0068866_1062789013300005718Miscanthus RhizosphereMATKEHKPVGSKQRKAIKFSDSLVEIAYVCESCGTEIKRT
Ga0068863_10062019823300005841Switchgrass RhizosphereMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTILEN*
Ga0070717_1067759613300006028Corn, Switchgrass And Miscanthus RhizosphereKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIRK*
Ga0070717_1216055713300006028Corn, Switchgrass And Miscanthus RhizosphereEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0075365_1020173623300006038Populus EndosphereICPRCRRRMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0075365_1073183923300006038Populus EndosphereMATKEHKPFGPKQRKAIKFSDGLVEVAYVCESCGTEIKRTIREK*
Ga0075417_1044750813300006049Populus RhizosphereMATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREN*
Ga0070712_10039393333300006175Corn, Switchgrass And Miscanthus RhizosphereMATKEYSPTEPKARKAIKFSDTLVEVAYVCESCGTEIKRTIREK*
Ga0074047_1190292623300006576SoilMATKEHKPVGPKQRKAIKFSDSLVDVAYVCESCGTEIKRTIREK*
Ga0066658_1079897223300006794SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTE
Ga0075428_10038921123300006844Populus RhizosphereMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0075424_10075581533300006904Populus RhizosphereMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREQ*
Ga0075418_1053364523300009100Populus RhizosphereMVTKEYRPLGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0075418_1103648823300009100Populus RhizosphereMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0075418_1220791213300009100Populus RhizosphereMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIR
Ga0099792_1091441513300009143Vadose Zone SoilKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET*
Ga0114129_1276459423300009147Populus RhizosphereMVTKEYRPMGPKARKAIKFTDSLVEVAYVCENCGAEIKRTIRES*
Ga0105242_1278634113300009176Miscanthus RhizospherePVGPNQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0105238_1176381913300009551Corn RhizosphereMATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIK
Ga0126313_1060462713300009840Serpentine SoilMATKDHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0134128_1105375133300010373Terrestrial SoilMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKHTIREN*
Ga0134127_1035632213300010399Terrestrial SoilMATKEHKPVGSKQRKAIKFSDSLVEIAYVCESCGTEIKRTIREK*
Ga0134123_1364914323300010403Terrestrial SoilEPKARKAVKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0150983_1253951213300011120Forest SoilMATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTE
Ga0120191_1016023523300012022TerrestrialMVTKEYRPRGPIARKAIKFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0137388_10015339103300012189Vadose Zone SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRE
Ga0137362_1118488113300012205Vadose Zone SoilMATKEHKPMGPEQHKAIRFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0137370_1096753613300012285Vadose Zone SoilMVTKEYRPGPETSKAITFTDSLVEVAYVCESCGTEIKRTMREK*
Ga0157295_1003986023300012906SoilMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTIREK*
Ga0137359_1010120613300012923Vadose Zone SoilEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK*
Ga0162652_10006848113300012941SoilRCRRRMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK*
Ga0164300_1002885143300012951SoilMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEI
Ga0164298_1035615213300012955SoilMATKEYKPMGPKARKAIKFTDSLVEVVYICESCGTEIK
Ga0164298_1064061123300012955SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREKARVLCNELA*
Ga0164298_1097339113300012955SoilMATKEHRPVGPKQRKAIKFSDSLVEVAYVCDSCGTEIKRTLRERWA*
Ga0164309_1009658023300012984SoilMATKEYTPTEPKARKAIKFSDSLVEVAYVCESCGTEIKR
Ga0164308_1076150523300012985SoilATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0164308_1218168513300012985SoilMATKEYKPMEPKARKAIKFSDSLVEVVYICESCGTEIKRTIREK*
Ga0164306_1202395023300012988SoilMATKEYKPMEPKARKAIKFSDSLVEVVYTCESCGTEIKRT
Ga0157378_1053074013300013297Miscanthus RhizosphereRMATKEYNPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREE*
Ga0163162_1095385813300013306Switchgrass RhizosphereMATTEHKPVGPKQRKAIKFSDGLVEVAYVCESCGTEIKRTIREK
Ga0173483_1075598523300015077SoilRMATKEHKPLGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK*
Ga0132258_10051700103300015371Arabidopsis RhizosphereMVTKEYRPRGPKARKDIKFTDSLVEVAYVCENCGTEIKRTIRET*
Ga0132255_10073012913300015374Arabidopsis RhizosphereMATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK*
Ga0132255_10115698213300015374Arabidopsis RhizosphereATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTILEN*
Ga0132255_10131991933300015374Arabidopsis RhizosphereMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIRGK*
Ga0182040_1167601813300016387SoilTKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK
Ga0182039_1079515313300016422SoilWPRCRRRMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK
Ga0184608_1005471623300018028Groundwater SedimentMATKEYNPMGPKQRKAIKFTDRLVEVAYVCESCGTEIKRTIREK
Ga0184634_1033859823300018031Groundwater SedimentPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0184626_1040078823300018053Groundwater SedimentPRCRRRMATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0184621_1003899123300018054Groundwater SedimentMATKEHNPMGPKQRKVIKFTDRLVEVAYVCESCGTEIKRTIREK
Ga0184625_1019600733300018081Groundwater SedimentCPRCRRRMATKEYNPMGPKQRKAIKFTDRLVEVAYVCESCGTEIKRTIREK
Ga0190274_1098110913300018476SoilMATKDHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0190274_1176744223300018476SoilMATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKR
Ga0184647_106584833300019263Groundwater SedimentMATKEHRPTGPKARKAIKFSDSLVEVAYICDSCGTEIK
Ga0173482_1010656213300019361SoilMATKEHKPMEPKARKAIKFSDSLVEVVYICESCGT
Ga0173482_1017128213300019361SoilMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTIREN
Ga0193696_103759733300020016SoilMATKEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0179592_1029918913300020199Vadose Zone SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET
Ga0210399_1059383313300020581SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKR
Ga0210406_1015574033300021168SoilMATKEYSPMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0210402_1054813823300021478SoilMATKEYKPMEPKARKAIKFTDSLVEVVYLCESCGTEIKRTIREN
Ga0207693_1073844823300025915Corn, Switchgrass And Miscanthus RhizosphereRRRMATKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0207664_1042182813300025929Agricultural SoilCLACPTEPKARKAVKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0207644_1019566013300025931Switchgrass RhizosphereMATKEYKPMEPKARKPIKFTDSLVEVVYICESCGTEIKRTILEN
Ga0207644_1034187223300025931Switchgrass RhizosphereRCRRRMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREK
Ga0207704_1028834523300025938Miscanthus RhizosphereEHKPVGPKQRKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0208709_10496523300026693SoilRMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIKRTIREK
Ga0209331_103297223300027603Forest SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREN
Ga0209625_112444623300027635Forest SoilMATKEYNPMEPKARKAIKFTDSLVEVVYLCESCGTEIKRTIREK
Ga0209388_110693033300027655Vadose Zone SoilKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIRET
Ga0209814_1053324013300027873Populus RhizosphereMATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIREN
Ga0209382_1007380743300027909Populus RhizosphereMVTKEYRPLGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK
Ga0209382_1160384723300027909Populus RhizosphereATKEHKPMGPKQRKAIRFTDSLVEVAYVCESCGTEIKRTIRESRPP
Ga0209526_1057567733300028047Forest SoilMATKEHKPMGPEQRKAIRFTDSLVEVAYVCESCGTEIK
Ga0209526_1068103023300028047Forest SoilMATKEHKPMGPEQCKAIRFTDSLVEVAYVCESCGTEIKRTIRK
Ga0307280_1042024713300028768SoilMATKEYSPTEPKARKAIKFSDTLVEVAYVCESCGTEIKRTIRE
Ga0307282_1020928613300028784SoilKEYSPTEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0307323_1027526913300028787SoilMATKEYSPTEPKARKAIKFSDTLVEVAYVCESCGTEIKRTIREK
Ga0307289_1027172313300028875SoilMATKEHRPTGPKARKAIKFSDSLVEVAYVCDSCGTEIKRTLRER
Ga0307469_1022495713300031720Hardwood Forest SoilMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK
Ga0307468_10032386213300031740Hardwood Forest SoilVICPRCRRRMVTKEYRPRGPKARKAIKFTDSLVEVAYVCESCGTEIKRTIREK
Ga0307470_1002650533300032174Hardwood Forest SoilMEPKARKAIKFSDSLVEVAYVCESCGTEIKRTIREK
Ga0307471_10391706013300032180Hardwood Forest SoilMATKEYKPMEPKARKAIKFTDSLVEVVYICESCGTEIKRTIREQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.