Basic Information | |
---|---|
Family ID | F087544 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 42 residues |
Representative Sequence | FANPRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYG |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.64 % |
% of genes near scaffold ends (potentially truncated) | 96.36 % |
% of genes from short scaffolds (< 2000 bps) | 92.73 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.091 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF03972 | MmgE_PrpD | 69.09 |
PF04909 | Amidohydro_2 | 4.55 |
PF04286 | DUF445 | 2.73 |
PF09084 | NMT1 | 1.82 |
PF04392 | ABC_sub_bind | 0.91 |
PF00355 | Rieske | 0.91 |
PF01546 | Peptidase_M20 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 69.09 |
COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 2.73 |
COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 2.73 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.82 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.82 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_103500016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300001661|JGI12053J15887_10060723 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
3300004267|Ga0066396_10032712 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300005332|Ga0066388_101967522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1046 | Open in IMG/M |
3300005332|Ga0066388_102382320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
3300005332|Ga0066388_105077883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300005455|Ga0070663_101735401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300005456|Ga0070678_100215209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1594 | Open in IMG/M |
3300005457|Ga0070662_101246785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
3300005536|Ga0070697_101252581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
3300005554|Ga0066661_10387546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
3300005586|Ga0066691_10275634 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300005713|Ga0066905_100606266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 927 | Open in IMG/M |
3300005713|Ga0066905_100902252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
3300005713|Ga0066905_101615493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
3300005713|Ga0066905_101727913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300005713|Ga0066905_102018158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300005764|Ga0066903_107005879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300005764|Ga0066903_107052267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
3300005764|Ga0066903_107699500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
3300005764|Ga0066903_108443207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300005764|Ga0066903_108917145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
3300005841|Ga0068863_102157271 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006048|Ga0075363_100752998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
3300006051|Ga0075364_10907521 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300006175|Ga0070712_101168128 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300006574|Ga0074056_11721914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300006791|Ga0066653_10298035 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300006845|Ga0075421_101263298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
3300006853|Ga0075420_100584032 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300007076|Ga0075435_101148964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
3300009038|Ga0099829_11625809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
3300009088|Ga0099830_10913332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
3300009090|Ga0099827_10263384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1452 | Open in IMG/M |
3300009100|Ga0075418_13023373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300009147|Ga0114129_13524623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300009148|Ga0105243_11771711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 648 | Open in IMG/M |
3300009156|Ga0111538_11645390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
3300010047|Ga0126382_11170281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
3300010047|Ga0126382_11279148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
3300010048|Ga0126373_11932343 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300010359|Ga0126376_12596839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
3300010361|Ga0126378_10309957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1683 | Open in IMG/M |
3300010397|Ga0134124_10281054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1543 | Open in IMG/M |
3300012199|Ga0137383_10934743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
3300012206|Ga0137380_11638510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
3300012209|Ga0137379_11555355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
3300012363|Ga0137390_11992670 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012469|Ga0150984_112149996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300012532|Ga0137373_10621420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
3300012917|Ga0137395_10599268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
3300012924|Ga0137413_10614638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
3300012951|Ga0164300_10030793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1967 | Open in IMG/M |
3300012971|Ga0126369_11378760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
3300012972|Ga0134077_10325566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300012989|Ga0164305_10999210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
3300013306|Ga0163162_11883747 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
3300014968|Ga0157379_11492715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
3300014968|Ga0157379_11871663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300015371|Ga0132258_10449196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3213 | Open in IMG/M |
3300015373|Ga0132257_100031181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5774 | Open in IMG/M |
3300015374|Ga0132255_100952148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1286 | Open in IMG/M |
3300016270|Ga0182036_10146813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1674 | Open in IMG/M |
3300016341|Ga0182035_10334602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1253 | Open in IMG/M |
3300016445|Ga0182038_10220356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1507 | Open in IMG/M |
3300017965|Ga0190266_10593022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300018082|Ga0184639_10484273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
3300018469|Ga0190270_12312244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
3300019356|Ga0173481_10047570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1462 | Open in IMG/M |
3300021406|Ga0210386_11742233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300021560|Ga0126371_11307133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
3300026310|Ga0209239_1192798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 747 | Open in IMG/M |
3300027583|Ga0209527_1065189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
3300027610|Ga0209528_1118780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300027663|Ga0208990_1102988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300027846|Ga0209180_10580453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300028379|Ga0268266_10806407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 907 | Open in IMG/M |
3300028592|Ga0247822_11802051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300028705|Ga0307276_10194413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300028799|Ga0307284_10134859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 944 | Open in IMG/M |
3300028807|Ga0307305_10169376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
3300028809|Ga0247824_10298806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 906 | Open in IMG/M |
3300031152|Ga0307501_10186974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300031184|Ga0307499_10056206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300031538|Ga0310888_10414619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 793 | Open in IMG/M |
3300031543|Ga0318516_10757716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300031668|Ga0318542_10181573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1056 | Open in IMG/M |
3300031681|Ga0318572_10810673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300031723|Ga0318493_10159944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1170 | Open in IMG/M |
3300031744|Ga0306918_10240039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1380 | Open in IMG/M |
3300031751|Ga0318494_10385022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
3300031751|Ga0318494_10551227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
3300031763|Ga0318537_10090749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1129 | Open in IMG/M |
3300031771|Ga0318546_11083052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
3300031796|Ga0318576_10254432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
3300031799|Ga0318565_10570486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300031819|Ga0318568_10311692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 977 | Open in IMG/M |
3300031846|Ga0318512_10027455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 2411 | Open in IMG/M |
3300031879|Ga0306919_11200405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
3300031894|Ga0318522_10008811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2974 | Open in IMG/M |
3300031910|Ga0306923_12537347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300031942|Ga0310916_10243453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1514 | Open in IMG/M |
3300031942|Ga0310916_10301682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1356 | Open in IMG/M |
3300031959|Ga0318530_10003805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4376 | Open in IMG/M |
3300032025|Ga0318507_10025134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2162 | Open in IMG/M |
3300032039|Ga0318559_10023905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2372 | Open in IMG/M |
3300032044|Ga0318558_10647530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
3300032052|Ga0318506_10242339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
3300032076|Ga0306924_11004769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
3300032261|Ga0306920_102950324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.45% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.82% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1035000162 | 3300000559 | Soil | FANPRVIAEMIKTYESGXXXXXRRAEIDRANALALFPKYA* |
JGI12053J15887_100607234 | 3300001661 | Forest Soil | ANPRVIAEALSTYESGFLSEERRFAIDRGNALGLLPKYATAV* |
Ga0066396_100327121 | 3300004267 | Tropical Forest Soil | VVFGTDYPFANPRVIAEMVKTYESGFLSQARRAEIDRTNALALFPKYC* |
Ga0066388_1019675221 | 3300005332 | Tropical Forest Soil | VFGTDYPFANPRVIAEMIKTYESGFLSDARRAQIDRANALALFPKYA* |
Ga0066388_1023823202 | 3300005332 | Tropical Forest Soil | ANPRVIAEMIKTYESGFLPDARRADIDRTNALALFSKYA* |
Ga0066388_1050778832 | 3300005332 | Tropical Forest Soil | ANPRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYG* |
Ga0070663_1017354012 | 3300005455 | Corn Rhizosphere | TDFPFANPRVIAEMIKTHESGFLSAARRADIDRANALALFPKYG* |
Ga0070678_1002152092 | 3300005456 | Miscanthus Rhizosphere | FPFANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG* |
Ga0070662_1012467851 | 3300005457 | Corn Rhizosphere | TDFPFANPRVIAEMIKTHESGFLSGARRAEIDRANALALFPKYG* |
Ga0070697_1012525811 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAEMIKTYESGFLSASRRAEIDRGNALALFPDMGESRD* |
Ga0066661_103875461 | 3300005554 | Soil | VVFGTDYPFANPRVIAEMIKTYESGFLSDARRAQIDRTNALALFPKYG* |
Ga0066691_102756342 | 3300005586 | Soil | YPFANPRVIAEMIKTYESGFLSDARRAQIDRTNALALFPKYG* |
Ga0066905_1006062662 | 3300005713 | Tropical Forest Soil | VFGTDYPFANPRVIAEMIKTYESGFLSPARRAQIDRTNAPALFPKYA* |
Ga0066905_1009022521 | 3300005713 | Tropical Forest Soil | FANPRVIAEMIRTYESGFLPDARRAAIDRANALALFPKYRISE* |
Ga0066905_1016154931 | 3300005713 | Tropical Forest Soil | RVIAEMIKTYESGFLSDARRAEIDRANALALFPKYA* |
Ga0066905_1017279131 | 3300005713 | Tropical Forest Soil | FANPRVIAEMIRTYESGFLPDARRAAIDRANALALFPKYRVSE* |
Ga0066905_1020181582 | 3300005713 | Tropical Forest Soil | VFGTDYPFANPRVIAEMIKTYESGFLSPARRAQIDRTNALALFPKYE* |
Ga0066903_1070058792 | 3300005764 | Tropical Forest Soil | PGVIAEAVKTHESGFLPDARRAAIDRGNALALFPKHGA* |
Ga0066903_1070522671 | 3300005764 | Tropical Forest Soil | RVIAEMIKTYESGSFSDARRAEIDRANALALFPKYV* |
Ga0066903_1076995002 | 3300005764 | Tropical Forest Soil | FANPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYA* |
Ga0066903_1084432072 | 3300005764 | Tropical Forest Soil | GTDYPFANPRVIAEMIKTYESGFLSGARRAEIDRANALALFPNYG* |
Ga0066903_1089171452 | 3300005764 | Tropical Forest Soil | FANPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYG* |
Ga0068863_1021572712 | 3300005841 | Switchgrass Rhizosphere | TDFPFANPRVIAEMIRTHESGFLPDARRADIDRTNALALFPKYG* |
Ga0075363_1007529981 | 3300006048 | Populus Endosphere | DYPFANPRVIAEAVKTHEAGFLDGGRRAAIDRGNALALFPKYV* |
Ga0075364_109075212 | 3300006051 | Populus Endosphere | FPFANPRVIAEMIRTYESGFLPDDRRAAIDRTNALALFPKYRISE* |
Ga0070712_1011681282 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SDYPFANARVIAEMIKTYESGFLSDARRAAIDRGNALALFPRYG* |
Ga0074056_117219141 | 3300006574 | Soil | FANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG* |
Ga0066653_102980351 | 3300006791 | Soil | YPFANPRVIAEMIKTYESGFLSPARRAEIDRGNALALFPKYG* |
Ga0075421_1012632981 | 3300006845 | Populus Rhizosphere | FANPRVIAEMIKTYESGFLSQTRRAQIDRANALALFPKYG* |
Ga0075420_1005840322 | 3300006853 | Populus Rhizosphere | VVFGTDFPFANPRVIAEMIRTYESGFLPDDRRAAIDRTNALALFPKYRISE* |
Ga0075435_1011489642 | 3300007076 | Populus Rhizosphere | NPRVIAEMIRTHESGFLPDARRADIDRTNAIALFPKYG* |
Ga0099829_116258092 | 3300009038 | Vadose Zone Soil | RPERIVFGSDFPFANPRVIAEAVKTHEAGFLPEARRIAVDRANALALFPKYAV* |
Ga0099830_109133322 | 3300009088 | Vadose Zone Soil | PERIVFGSDFPFANPRVIAQAVKTYESGFLSEGRRMAIDRANALALFPKYAA* |
Ga0099827_102633841 | 3300009090 | Vadose Zone Soil | IAEMIKTYESGFLSDARRAEIDRANALALFPKYG* |
Ga0075418_130233732 | 3300009100 | Populus Rhizosphere | VFGTDFPFANPRVIAEMIRTYEGGFLPPVRRAAIDRANALALFPKYGVSE* |
Ga0114129_135246231 | 3300009147 | Populus Rhizosphere | IAEMIKTYESGFLSAARRAEIDRANVLALFPNYG* |
Ga0105243_117717112 | 3300009148 | Miscanthus Rhizosphere | FPFANPRVIAEMIKTHESGFLSAARRADIDRANALALFPKYG* |
Ga0111538_116453902 | 3300009156 | Populus Rhizosphere | FGTDFPFANPNVIAEAVKTHESGFLDANRSAAIDRGNALALFPRYRGL* |
Ga0126382_111702811 | 3300010047 | Tropical Forest Soil | TDYPFANPRVIAEMIKTYESGFLSPARRAQIDRTNALALFPKYE* |
Ga0126382_112791482 | 3300010047 | Tropical Forest Soil | FANARVIAEMIKTYESGFLSPARRAEIDRGNALALFPKYS* |
Ga0126373_119323433 | 3300010048 | Tropical Forest Soil | FPFANPRVVAQAVATYEAPFLPPERRSAIDRANALALFPKYAG* |
Ga0126376_125968392 | 3300010359 | Tropical Forest Soil | YPFANPRVIAEMIKTYETGFLSDARRAEIDRANVLALFPKYG* |
Ga0126378_103099571 | 3300010361 | Tropical Forest Soil | IAEMIKTYESGFLSAARRAEIDRGNALALFPRYG* |
Ga0134124_102810542 | 3300010397 | Terrestrial Soil | RVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG* |
Ga0137383_109347431 | 3300012199 | Vadose Zone Soil | PFANARVIAEMIKTYESGFLSDARRAAIDRGNALALFPRYG* |
Ga0137380_116385102 | 3300012206 | Vadose Zone Soil | FANPRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYG* |
Ga0137379_115553552 | 3300012209 | Vadose Zone Soil | SDYPFANARVIAEMVKTYESGFLSEGRRAQIDRGNALALFPKYS* |
Ga0137390_119926701 | 3300012363 | Vadose Zone Soil | PRVIAEMVKTHESGFLADAKRAAIDRSNALALFPKFA* |
Ga0150984_1121499961 | 3300012469 | Avena Fatua Rhizosphere | TDFPFANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG* |
Ga0137373_106214202 | 3300012532 | Vadose Zone Soil | VIAEMIKTYESGFLSDARRAEIDRANALALFPKYG* |
Ga0137395_105992682 | 3300012917 | Vadose Zone Soil | FGTDYPFANPRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYG* |
Ga0137413_106146381 | 3300012924 | Vadose Zone Soil | PFANPHVIGEAVTTYESGFLSDARRAAIDRGNALALFPKYA* |
Ga0164300_100307931 | 3300012951 | Soil | TDFPFANPRVIAEMIRTYESGFLTDARRADIDRTNALALFPKYG* |
Ga0126369_113787601 | 3300012971 | Tropical Forest Soil | PDVIAEMVQTYESGFLSDARRAAIDRGNALALFPKYA* |
Ga0134077_103255662 | 3300012972 | Grasslands Soil | ARVIAEMVKTYESGFLSEGRRVQIDRGNALALFPKYS* |
Ga0164305_109992101 | 3300012989 | Soil | TDFPFANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYR* |
Ga0163162_118837471 | 3300013306 | Switchgrass Rhizosphere | FGTDFPFANPRVIAEMIRTYESGFLPDARRADIDRTNALALFPKYG* |
Ga0157379_114927152 | 3300014968 | Switchgrass Rhizosphere | FANPRVIAEMIKTHQSGFLSDARRAEIDRANALALFPKYG* |
Ga0157379_118716632 | 3300014968 | Switchgrass Rhizosphere | PFANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG* |
Ga0132258_104491965 | 3300015371 | Arabidopsis Rhizosphere | DFPFANARVIAEAVKTHESGFLPEVRRAAIDRENALALFPKYAR* |
Ga0132257_1000311819 | 3300015373 | Arabidopsis Rhizosphere | IAEMIKTYESGFLSAARRAEIDRANALALFPNYG* |
Ga0132255_1009521481 | 3300015374 | Arabidopsis Rhizosphere | DFPFANPRVIAEMIRTYESGFLPDDRRAAIDRANALALFPKYRVSD* |
Ga0182036_101468132 | 3300016270 | Soil | PFANPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYG |
Ga0182035_103346021 | 3300016341 | Soil | ANPRVVAQAVATYEAGFLPPERRTAIDRANVLALFPKYAG |
Ga0182038_102203562 | 3300016445 | Soil | ANPRVIAEMIKTYESGFLSEARRAQIDRTNALSLFPRYA |
Ga0190266_105930222 | 3300017965 | Soil | FANPHVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG |
Ga0184639_104842732 | 3300018082 | Groundwater Sediment | DHVALPERSVCGPDLPCANPRESAEMIRTYESGFLSEARRAEIGRTNALALFPRFG |
Ga0190270_123122442 | 3300018469 | Soil | PFANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKFG |
Ga0173481_100475701 | 3300019356 | Soil | TDFPFANPRVIAEMIRTHESGFLPDARRADIDRTNALALFPKYG |
Ga0210386_117422332 | 3300021406 | Soil | TDYPFANPRVIAEMIKTYESGFLSAARRAEIDRGNALALFPNYG |
Ga0126371_113071331 | 3300021560 | Tropical Forest Soil | RVIAEMIQTHESGFLSDARRAQIDRANALALFPKYG |
Ga0209239_11927981 | 3300026310 | Grasslands Soil | RVIAEMIKTYESGFLSDARRAQIDRANALALFPKYG |
Ga0209527_10651891 | 3300027583 | Forest Soil | DFPFANPRVIAEALSTYESGFLSEERRFAIDRANALALLPKYATAV |
Ga0209528_11187801 | 3300027610 | Forest Soil | ANPRVIAEALSTYESGFLSEERRFAIDRANALALLPKYATAV |
Ga0208990_11029881 | 3300027663 | Forest Soil | GTDYPFANPRVIAEMIRTYESGFLSEARRAEIGRANALTLFPKYG |
Ga0209180_105804532 | 3300027846 | Vadose Zone Soil | ERIVFGSDFPFANPRVIAEAVKTHEAGFLPEARRIAVDRANALALFPKYAV |
Ga0268266_108064071 | 3300028379 | Switchgrass Rhizosphere | ANPRVIAEMIKTHESGFLSAARRADIDRANALALFPKYG |
Ga0247822_118020511 | 3300028592 | Soil | VVFGTDFPFANPRVIAEMIKTHESGFLSYARRAEIDRANALALFPKYG |
Ga0307276_101944132 | 3300028705 | Soil | VFGTDYPFANPRVIAEMIKTYESGFLSAARRAEIDRGNALALFPS |
Ga0307284_101348592 | 3300028799 | Soil | RVIAEMIRTYESGFLSEARRAEIGRANALTLFPKYG |
Ga0307305_101693762 | 3300028807 | Soil | PFANPRVIAEMIRTYESGFLSEARRAEIGRANALTLFPKYG |
Ga0247824_102988062 | 3300028809 | Soil | VVFGTDFPFANPRVIAEMIKTHESGFLSDVRRAEIDRANALALFPKYG |
Ga0307501_101869742 | 3300031152 | Soil | FANPRVIAEMIRTYESGFLSEARRAEIGRTNALTLFPKYG |
Ga0307499_100562062 | 3300031184 | Soil | PRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG |
Ga0310888_104146192 | 3300031538 | Soil | VVFGTDFPFANPRVIAEMIKTHESGFLSDARRAEIDRANALALFPKYG |
Ga0318516_107577162 | 3300031543 | Soil | NPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYA |
Ga0318542_101815733 | 3300031668 | Soil | TDFPFANPRVVAQAVATYEAGFLPPERRTAIDRANVLALFPKYAG |
Ga0318572_108106731 | 3300031681 | Soil | YPFANPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYA |
Ga0318493_101599442 | 3300031723 | Soil | VFGTDFPFANPRVVAQAVATYEGPFLPPERRTAIDRANALALFPKYAG |
Ga0306918_102400392 | 3300031744 | Soil | VRVIAEAVKTYEAGFLSQERRFAIDRGNALALFPKYANTSSQS |
Ga0318494_103850221 | 3300031751 | Soil | VIAEMIKTYESGFLSEARRAQIDRTNALSLFPRYA |
Ga0318494_105512272 | 3300031751 | Soil | TDVIAEMVQTYESGFLSDARRAAIDRGNALALFPKYA |
Ga0318537_100907493 | 3300031763 | Soil | PFANPRVVAQAVATYEAGFLPPERRTAIDRANVLALFPKYAG |
Ga0318546_110830522 | 3300031771 | Soil | ANARVVAQAVATYEGPFLPPERRTAIDRANALALFPKYAG |
Ga0318576_102544321 | 3300031796 | Soil | GTDFPFANPRVIAEMIKTYESGFLSEARRAQIDRTNALSLFPRYA |
Ga0318565_105704861 | 3300031799 | Soil | PRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYA |
Ga0318568_103116921 | 3300031819 | Soil | ANPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYA |
Ga0318512_100274553 | 3300031846 | Soil | VFGTDFPFANPRVIAEMVKTYESGFLSQARRAQIDRTNALALFPKYC |
Ga0306919_112004052 | 3300031879 | Soil | PHVIAEMIKTYESGFLSDARRAEIDRANALALFPKYR |
Ga0318522_100088113 | 3300031894 | Soil | VFGTDYPFANPRVIAEMIKTYESGFLSQARRAQIDRTNALALFPKYG |
Ga0306923_125373471 | 3300031910 | Soil | NPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYG |
Ga0310916_102434532 | 3300031942 | Soil | VDRVAFPECVVFGTVYAFAIPRFFAEMIKTYESGFLSDARRAQIDRANALALFPKYA |
Ga0310916_103016822 | 3300031942 | Soil | TDYPFANPRVIAEMIKTYESGFLSEARRAQIDRANALALFPKYG |
Ga0318530_100038054 | 3300031959 | Soil | NPRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYA |
Ga0318507_100251343 | 3300032025 | Soil | VFGTDYPFANPRVIAEMIKTYESGFLSDARRAEIDRANALALFPKYA |
Ga0318559_100239051 | 3300032039 | Soil | PRVVAQAVATYEGPFLPPERRTAIDRANALALFPKYAG |
Ga0318558_106475302 | 3300032044 | Soil | PDVIAEMVQTYESGFLSDARRAAIDRGNALALFPKYA |
Ga0318506_102423392 | 3300032052 | Soil | RVVARAVATYEAGFLPPERRTAIDRANVLALFPKYAG |
Ga0306924_110047691 | 3300032076 | Soil | RVIAEMIQTHESGFLSDARRAQIDRANALALFPKYA |
Ga0306920_1029503241 | 3300032261 | Soil | DYPFANPRVIAEMIQTHESGFLSDARRAQIDRANALALFPKYA |
⦗Top⦘ |