NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087276

Metagenome / Metatranscriptome Family F087276

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087276
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 104 residues
Representative Sequence MILSWNDWYMANNGIGTPVKWDPSNNPSHMIRSEVSDVYKAMTKIRALEKKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVAAFS
Number of Associated Samples 96
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 21.10 %
% of genes near scaffold ends (potentially truncated) 28.18 %
% of genes from short scaffolds (< 2000 bps) 99.09 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (80.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(23.636 % of family members)
Environment Ontology (ENVO) Unclassified
(55.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(70.909 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.09%    β-sheet: 0.00%    Coil/Unstructured: 63.91%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.91 %
UnclassifiedrootN/A19.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004692|Ga0065171_1051868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300004789|Ga0007752_11018693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300004810|Ga0007757_11405618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bartonellaceae → Bartonella → Bartonella koehlerae517Open in IMG/M
3300005516|Ga0066831_10092843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium816Open in IMG/M
3300006112|Ga0007857_1050326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium803Open in IMG/M
3300006121|Ga0007824_1052377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium782Open in IMG/M
3300006356|Ga0075487_1354053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium684Open in IMG/M
3300006803|Ga0075467_10443118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300007516|Ga0105050_10677629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300007554|Ga0102820_1121310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium629Open in IMG/M
3300007725|Ga0102951_1136415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium692Open in IMG/M
3300008929|Ga0103732_1029103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium816Open in IMG/M
3300008993|Ga0104258_1090720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300008993|Ga0104258_1100171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300009023|Ga0103928_10413271Not Available527Open in IMG/M
3300009068|Ga0114973_10514388Not Available619Open in IMG/M
3300009071|Ga0115566_10418480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium770Open in IMG/M
3300009071|Ga0115566_10520019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300009151|Ga0114962_10711356Not Available513Open in IMG/M
3300009265|Ga0103873_1038962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium879Open in IMG/M
3300009434|Ga0115562_1194912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300009466|Ga0126448_1124341Not Available584Open in IMG/M
3300009497|Ga0115569_10216300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium877Open in IMG/M
3300009543|Ga0115099_10886874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium786Open in IMG/M
3300009592|Ga0115101_1028940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium834Open in IMG/M
3300009592|Ga0115101_1253623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300009599|Ga0115103_1051086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300009599|Ga0115103_1602019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300009606|Ga0115102_10170892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300009679|Ga0115105_11108820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium529Open in IMG/M
3300010368|Ga0129324_10270577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300012413|Ga0138258_1749494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300012415|Ga0138263_1850250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300012504|Ga0129347_1089729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium854Open in IMG/M
3300012504|Ga0129347_1125782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300012523|Ga0129350_1225011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium512Open in IMG/M
3300012782|Ga0138268_1122047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium712Open in IMG/M
3300012953|Ga0163179_10683675Not Available869Open in IMG/M
3300012953|Ga0163179_11780084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300012970|Ga0129338_1059423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300013006|Ga0164294_11234548Not Available501Open in IMG/M
3300013295|Ga0170791_11827787Not Available695Open in IMG/M
3300016732|Ga0182057_1369352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300016742|Ga0182052_1430785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium559Open in IMG/M
3300017818|Ga0181565_10531720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium761Open in IMG/M
3300017951|Ga0181577_10585401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium689Open in IMG/M
3300018418|Ga0181567_10526398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium770Open in IMG/M
3300018420|Ga0181563_10513002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018628|Ga0193355_1023660Not Available583Open in IMG/M
3300018692|Ga0192944_1041218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium668Open in IMG/M
3300018765|Ga0193031_1073762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium577Open in IMG/M
3300018766|Ga0193181_1025665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium837Open in IMG/M
3300018846|Ga0193253_1073433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium830Open in IMG/M
3300018846|Ga0193253_1082597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium770Open in IMG/M
3300018874|Ga0192977_1067076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium728Open in IMG/M
3300018885|Ga0193311_10038276Not Available691Open in IMG/M
3300018980|Ga0192961_10103955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium861Open in IMG/M
3300018982|Ga0192947_10184570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium690Open in IMG/M
3300018989|Ga0193030_10208238Not Available644Open in IMG/M
3300018989|Ga0193030_10256164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300019021|Ga0192982_10379587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300019036|Ga0192945_10130911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium803Open in IMG/M
3300019048|Ga0192981_10206510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium765Open in IMG/M
3300019051|Ga0192826_10188950Not Available762Open in IMG/M
3300019051|Ga0192826_10248295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300019051|Ga0192826_10365622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300019116|Ga0193243_1037560Not Available669Open in IMG/M
3300019282|Ga0182075_1770955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium509Open in IMG/M
3300019459|Ga0181562_10382207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium683Open in IMG/M
3300020014|Ga0182044_1111290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300021169|Ga0206687_1582719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300021342|Ga0206691_1275969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300021350|Ga0206692_1488693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300021371|Ga0213863_10211863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium847Open in IMG/M
3300021872|Ga0063132_118203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300021872|Ga0063132_119486Not Available506Open in IMG/M
3300021962|Ga0222713_10508290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium719Open in IMG/M
3300025385|Ga0207956_1045048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300025399|Ga0208107_1060802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300025620|Ga0209405_1172055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium538Open in IMG/M
3300025640|Ga0209198_1137591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium696Open in IMG/M
3300025699|Ga0209715_1170862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300025712|Ga0209305_1178678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium633Open in IMG/M
3300025887|Ga0208544_10270286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium672Open in IMG/M
3300025894|Ga0209335_10306653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300026130|Ga0209961_1088067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium542Open in IMG/M
3300026182|Ga0208275_1061318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300026448|Ga0247594_1048966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300027720|Ga0209617_10254953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium664Open in IMG/M
3300027741|Ga0209085_1373163Not Available521Open in IMG/M
3300027749|Ga0209084_1337194Not Available557Open in IMG/M
3300027976|Ga0209702_10344925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300028137|Ga0256412_1196854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium744Open in IMG/M
3300028137|Ga0256412_1206463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium725Open in IMG/M
3300028282|Ga0256413_1298554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium568Open in IMG/M
3300028290|Ga0247572_1162039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300030702|Ga0307399_10386407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium677Open in IMG/M
3300030709|Ga0307400_10510719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium758Open in IMG/M
3300030725|Ga0308128_1034729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium598Open in IMG/M
3300031710|Ga0307386_10416617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300031710|Ga0307386_10582473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium591Open in IMG/M
3300031710|Ga0307386_10705396Not Available540Open in IMG/M
3300031725|Ga0307381_10240631Not Available640Open in IMG/M
3300031734|Ga0307397_10470769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium585Open in IMG/M
3300031735|Ga0307394_10447936Not Available518Open in IMG/M
3300031738|Ga0307384_10566822Not Available542Open in IMG/M
3300031739|Ga0307383_10551651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300032522|Ga0314677_10628569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M
3300034022|Ga0335005_0363173Not Available841Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine23.64%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.55%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.18%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.27%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.36%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.45%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.55%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.55%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.64%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.73%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.82%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.82%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.82%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.91%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.91%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.91%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.91%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.91%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.91%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.91%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.91%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.91%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004692Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006112Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08EnvironmentalOpen in IMG/M
3300006121Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025385Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025399Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0065171_105186813300004692FreshwaterMAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFNLNSGETNYDWNLLNSLKRELGIPVEFADDRKSL*
Ga0007752_1101869323300004789Freshwater LakeMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQ
Ga0007757_1140561813300004810Freshwater LakeMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNIS
Ga0066831_1009284323300005516MarineMLLSWYDWWLSQNALGVKDKWDPENNPAHMIRSEVSDIYKAMTKIRALENKVKKFDPNSGTTNQDWNLLNSLKRELGINVEFGDDKKA*
Ga0007857_105032633300006112FreshwaterMAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFNLNSGETNYDWNLLNSLKRELGIPVEFADDRKSLQGEGSIPTKTVVAFN*
Ga0007824_105237723300006121FreshwaterMAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFNLNSGETNYDWNLLNSLKRELGIPVEFADDRKSLEGEGSIPTKTVVAFN*LS*DFIYLRK
Ga0075487_135405313300006356AqueousMILSWHDWWLAHNALGHPTDWNPEQNPAHMVRSEVNDIYKAMTKIRALENKLKNYKGNGDTNYDWNLLNSLKREVGIAVEFPGDNKTALAGEGDIPAKAVAANM*
Ga0075467_1044311813300006803AqueousMISKLQDPMNGLILSWNDWWMAHNALGHTGEWDPEGNPHHMVRSEVNDIYKAMTKIRALEAKLSKEDPNSGTTNFDWNMLNSLKREVGLPVEFGNDKKSLSGDGNIASKAIAANM*
Ga0105050_1067762913300007516FreshwaterLAHNALGNTASWDPVNNPHHMIRSEVNDINKAMVKIRALEAKLSREDLNSGTTNFDWNLLNSLKREVGIPVEFANDKHSLAGDGNISSKVIAAHL*
Ga0102820_112131013300007554EstuarineMTSWNDWYLANNALGNEAKWDPDHNAHHMIRSEVNDIYKAMSKIRMLENKLRGQDSSGTTNFDWNLLNSLKREVGIPVEFANDKSALKGDGNIASKAMAANI*
Ga0102951_113641513300007725WaterMLLSWKDWFMAQNALGNPEKWSPETNPIHTIRSEVSDIYKAMTHIRMLENKLKNFDRNSGTTNADWNLLNSLKREIGINVEFGDDKSAQSGSGNIASKTMAANM*
Ga0103732_102910313300008929Ice Edge, Mcmurdo Sound, AntarcticaMILSWNDWYMSQNAMGAPEKWDPTHNPAHMIRGEVSDVYKAMNKIRALEGKLSKFPMNSGTTNADWSLLNSLKRELGIPVEFGDDKSALAGDGSVAAKSVVAHS*
Ga0104258_109072023300008993Ocean WaterMVLSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSV
Ga0104258_110017113300008993Ocean WaterMALGMISQLNNPIHGMILSWNDWWMAQNALGTPEKWSPATNPIHTIRSEVSDIYKAMTQIRMLENKLKNFDMNSGTTNADWNLLNSLKREVGINVEFGDDKKAQAGSGNIASKTMAATQ*
Ga0103928_1041327123300009023Coastal WaterMVYSWKDWYMANNILGAPTKWDPEHNPTHMIRSEVSDVYKAMTKIRALENRLKNSKLSGETNDDWNLLNSLKREVGIPVEFGDDKSAVQGEGD
Ga0114973_1051438813300009068Freshwater LakeMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNISTKTT
Ga0115566_1041848013300009071Pelagic MarineMVLSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVAAFS*
Ga0115566_1052001913300009071Pelagic MarineMALGMISQLNNPIHGMILSWNDWWMAQNALGTPEKWSPATNPIHTIRSEVSDIYKAMTQIRMLENKLKNFDMNSGTTNADWNLLNSLKREVGINVEFGDDKKAQAGAGNIASKTMAATQ*
Ga0114962_1071135613300009151Freshwater LakeMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNISTKTTVAFN*
Ga0103873_103896223300009265Surface Ocean WaterMISHIQDPIHNIILSWNDWWMSQNALGYPTVWDPVNNPVHMIKAEVDDVYKAMTKIRMLEKKLAKSGHNSGTTNADWNMLNSLKRELGIPVEFAGDAAQSLAGDGNVPTKATAAYL*
Ga0115562_119491213300009434Pelagic MarineMSQNGVGTPVEWDPKNNPSHMVRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEFASDAKTVLSGDGGVPSKSVAAFS*
Ga0126448_112434113300009466Meromictic PondMILSWKDWWMAQNGLGAPEKWSPETNPIHTIRSEVSDVYKAMTHIRMLENKLKNFDRNSGTTNYDWNLLNSLKREMGINVEFGNDKKAQAGQGNIASKVMAANM*
Ga0115569_1021630023300009497Pelagic MarineMSQNGVGTPVPWAPATNPTHMIRSEVSDVYKAMTKIRALEKKLSKFDLNSGETNEDWNMLNSLKREIGIPVEFSGDAKTVLAGDGGVPSKSVAAFS*
Ga0115099_1088687423300009543MarineMILSWNDWYMSQNALGAPEKWDPSHNPAHMIKSEVSDVYKAMNKIRALEMKLSKFPMNSGTTNQDWSLLNSLKRELGIPVEFGNDKTALAGEGSVTAKSTIASS*
Ga0115101_102894023300009592MarineMILSWNDWYMSQNALGAPEKWDPSHNPAHMVKSEVSDVYKAMNKIRALEMKLSKFPMNSGTTNQDWSLLNSLKRELGIPVEFGNDKTALAGEGSVTAKSTIASS*
Ga0115101_125362313300009592MarineMILSWNDWYMSQNGVGTPVEWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEFASDAKTVLSGD
Ga0115103_105108623300009599MarineMIARLQDPINGLLLSWNDWFMAHNALGAPTQWDPANNAHHMVRSEVSDIYKAMSTIRMLERKLAKDKSSGTTNFDWNLLNSLKREVGIPVEFANDKSALAGDGSVPSKAMAANM*
Ga0115103_160201913300009599MarineMILSWNDWWLSHNALGYPIKWDPEHNPQHMVRSEVNDIYKAMTKIRALENKMKNYKGQGDTNYDWNLLNSLKREVGIAVEFPSDNDKNLAGSGDVTSKAV
Ga0115102_1017089223300009606MarineMISKLQDPIHNMVLSWNDWWLAHNALGKPEKWDPINNPTHMIRSEASDVYKAMTKIRALEMKLKDFPKNSGSTNEDWNMLNSLKREIGIPVEFADDKKSLAGAGDLPTQATAAFS*
Ga0115105_1110882013300009679MarineMISKLQDPIHNMILSWNDWYMSQNGLGAPEKWDPDNNPAHMIRSEVSDVYKAMSKIRALEHKVAKFPKNSGTTNEDWNLLNSLKRELGVPVEFGDDKKALAGDGNIASKSTVAFS*
Ga0123361_104352413300009741MarineMISHIQDPIHNIILSWNDWWMSQNALGYPTVWDPVNNPVHLIKAEVDDVYKAMTKIRMLEKKLAKSGHNSGTTNADWNMLNSL
Ga0129324_1027057713300010368Freshwater To Marine Saline GradientMALGMISQLNNPIHGMILSWNDWWMAQNALGTPEKWSPATNPIHTIRSEVSDIYKAMTQIRMLENKLKNFDMNSGTTNADWNLLNSLKREVGINVEFGDDKKAQSGAGNIASKTMAATQ*
Ga0138258_174949413300012413Polar MarineMINNLQDPIHNMILSWNDWYMSQNGVGTPNAWDPTGNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGETNSDWNMLNSLKREVGIPVEFPGDSKKVLAVDGGVPSKSVAAFS*
Ga0138263_185025023300012415Polar MarineMILSWNDWYMSQNAMGASEKWDPTHNPAHMIRGEVSDVYKAMNKIRALEGKLSKFPMNSGTTNADWSLLNSLKRELGIPVEFGDDKSALAGDGSVAAKSVFAHS*
Ga0129347_108972923300012504AqueousMISHIQDPIHNIILSWNDWWMSQNALGYPTVWDPVNNPVHLIKAEVDDVYKAMTKIRMLEKKLAKSGHNSGTTNADWNMLNSLKRELGIPVEFAGDAAQSLAGDGNVPTKATAAYL*
Ga0129347_112578223300012504AqueousMINNLQDPIHNMILSWNDWYMANNGVGTPTTWDPKHNPAHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNADWNLLNSLKREIGIPVEFPQDAAQTLAGDGGVPSKSVAAFS*
Ga0129350_122501113300012523AqueousWQQLSLSLISHLQDPIHNTILSWHDWFMSQNAVGAPPVGGWDPVKNPIHMIRSEVSDVYKAMTKIRMLEKKLAKSGTNSGTTNEDWNMLNSLKRELGIPVEFAAEKAQSLAGDGDVPTKATAAYM*
Ga0138268_112204713300012782Polar MarineMSQNGVGTPVPWEPATNPSHMIRSEVSDVYKAMTKIRALEKKLSKFDMNSGSTNEDWNMLNSLKREIGIPVEFGEDKKTVLAGDGGVPSKSVAAFS*
Ga0163179_1068367523300012953SeawaterMILSWNDWWMSQNGIGSNESGEPAGNPAHMVRAEVSDIYKAMTKIRMLENKLKKFDMNSGKTNFDWNLLNSLKREMGINVEFGDNKGAQAGEGNVASKSMAAFS*
Ga0163179_1178008423300012953SeawaterMILSWNDWYMANNGIGTPVKWDPSNNPSHMIRSEVSDVYKAMTKIRALEKKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVAAFS*
Ga0129338_105942313300012970AqueousMTSWNDWYLANNALGNEAKWDPDHNAHHMIRSEVNDIYKAMSKIRMLENKLRGQDSSGTTNFDWNLLNSLKREVGIPVEFANDKSALKGDGNIASK
Ga0164294_1123454813300013006FreshwaterMILSWNDWYLAQNALGTPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNISTKTTVAFN*
Ga0170791_1182778713300013295FreshwaterMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNISTKTVVAFN*
Ga0182057_136935223300016732Salt MarshMINNLQDPIHNMILSWNDWYMANNGVGTPTSWDPKNNPAHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNADWNLLNSLKREIGIPVEFPQDAAQTLAGDGGVPSKSVAAFS
Ga0182052_143078513300016742Salt MarshMAQNALGATPNWAPNTNPIHTIRSEVSDIYKAMTHIRMLENKLKNFDMNSGTTNADWNLLNSLKREIGINVEFGKDKSALAGPGNIASKTMASTQXIDQXGKLQFIL
Ga0181565_1053172013300017818Salt MarshMILSWNDWYMANNGVGTPTSWDPKNNPAHMIRSAVSDVYKALTKIRALERKLSKYDMNSGTTNADWNLLNSLKREIGIPVEFPQDAAQTLAGDGGVPSKSVAAFS
Ga0181577_1058540113300017951Salt MarshMAQNALGATPNWAPNTNPIHTIRSEVSDIYKAMTHIRMLENKLKNFDMNSGTTNADWNLLNSLKREIGINVEFGKDKSALAGPGNIASKTMASTQXIDQXGKLQFI
Ga0181567_1052639813300018418Salt MarshMILSWNDWYMANNGVGTPTSWDPKNNPAHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNADWNLLNSLKREIGIPVEFPQDAAQTLAGDGGVPSKSVAAFS
Ga0181563_1051300213300018420Salt MarshMISQLNNPIHGMILSWNDWWMAQNALGTPEKWSPATNPIHTIRSEVSDIYKAMTQIRMLENKLKNFDMNSGTTNADWNLLNSLKREVGINVEFGDDKKAQSGAGNIASKTMAATQ
Ga0193355_102366023300018628MarineMVYSWKDWYMANNILGAPTKWDPEHNPTHMVRSEVSDVYKAMSKIRALENRLKNSKLSGETNDDWNLLNSLKREVGIPVEFGDDKPALKGEGDIPSKAVTAFGEAYNGF
Ga0192944_104121813300018692MarineMILSWNDWYMSQNGVGTPVQWDPKNNPSHMVRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEFASDAKTVLSGDGGVPSKSVAAFS
Ga0193031_107376213300018765MarineMILSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVAAFS
Ga0193181_102566523300018766MarineLDALLAANDDKDENWEQLSLNLISHLQDPIHNTILSWNDWWMSQNAVGHPTTWDPVNNPFHLIKAEVSDVYKAMTKIRMLEKKLAKEGTNSGTTNADWNMLNSLKRELGIPVEFAGDKA
Ga0193253_107343333300018846MarineMILSWNDWYMSQNALGAPEKWDPSHNPAHMVKSEVSDVYKAMNKIRALEMKLSKFPMNSGTTNQDWSLLNSLKRELGIPVEFGNDKTALAGEGSVTAKSTIASS
Ga0193253_108259713300018846MarineLDALLAANDDKDENWEQLSLNLISHLQDPIHNTILSWNDWWMSQNAVGHPTTWDPVNNPFHLIKAEVSDVYKAMTKIRMLEKKLAKEGANSGTTNADWNMLNSLKRELGIPVEFAGDKA
Ga0192977_106707613300018874MarineMILSWNDWYMSQNAMGAPEKWDPTHNPAHMIRGEVSDVYKAMNKIRALEGKLSKFPMNSGTTNADWSLLNSLKRELGIPVEFGDDKSALAGDGSVAAKSVVAHS
Ga0193311_1003827623300018885MarineMSQNAAGHPTTWDPVNNPFHLIKAEVSDVYKAMTKIRMLEKKLAKEGTNSGTTNADWNMLNSLKRELGIPVEFAGDKAQSLAGDGAVPTKVTAAYM
Ga0192961_1010395513300018980MarineMILSWNDWYMSQNALGAPEKWDPSHNPAHMIKSEVSDVYKAMNKIRALEMKLSKFPMNSGTTNQDWSLLNSLKRELGIPVEFGNDKTALAGEGSVTAKSTIASS
Ga0192947_1018457013300018982MarineMVLSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVAAFS
Ga0193030_1020823813300018989MarineLDQLLAGNNDDDENWQQLALSMISHLQDPIHNIILSWNDWWLSQNAVGYPTTWDPVNNPVHLIKSEVSDVYKAMSKIRMLEKKLAKSGQNSGTTNADWNMLNSLKRELGIPVEFAGDKAQSLAGEGDVPTKATAAYM
Ga0193030_1025616423300018989MarineMILSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALEKKLSKFDMNSGTTNEDWNMLNSLKREIGIPVEFPGDAAQTL
Ga0192982_1037958723300019021MarineENQSIEVISKLQDPIHNMILSWNDWYMSQNAMGAPEKWDPTHNPAHMIRGEVSDVYKAMNKIRALEGKLSKFPMNSGTTNADWSLLNSLKRELGIPVEFGDDKSALAGDGSVAAKSVVAH
Ga0192945_1013091113300019036MarineLSWNDWWLSQNAIGQPAAWDPEHNPVHLIRSEVSDVYKAMTKIRMLEKKVAKSGVNSGTTSADWNMLNSLKRELGIPVEFAGDKAQSLAGEGDVPTKTTAAYM
Ga0192981_1020651013300019048MarineMILSWNDWWLAHNALGHPTDWSPETNPAHMVRSEVSDIYKAMTKIRALENKVKNYKGTGDTNADWNMLNSLKREVGIPVEFPGDTKTVLAGEGDIPSKAVAANM
Ga0192826_1018895023300019051MarineMISHLQDPIHNTILSWNDWWLSQNAAGYPTAWDPVNNPVHLIRSEVSDVYKAMTKIRMLEKKLAKSGQNTGATNADWNMLNSLKRELGIPVEFAGDKAQSLAGEGDVPTKATAAYM
Ga0192826_1024829513300019051MarineLDALLAANDDKDENWEQLSLNLISHLQDPIHNTIMSWNDWWMSQNAVGHPTTWDPVNNPFHLIKAEVSDVYKAMTKIRMLEKKLAKEGANSGTTNADWNMLNSLKRELGIPVEFAGDKA
Ga0192826_1036562213300019051MarineMILSWNDWYMANNGIGTPVKWDPSNNPSHMIRSEVSDVYKAMTKIRALEKKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVAAFS
Ga0193243_103756023300019116MarineMAKKDEEDPNWESHSVEMISKLQDPIHNMILSWNDWYMSQNALGAPEKWDPAHNPAHMIKSEVSDVYKAMNKIRALEMKLSKFPMNSGTTNQDWSLLNSLKGELGIPVEFGDDKKALAGDGSMAAKSTI
Ga0182075_177095523300019282Salt MarshLSWNDWWLAHNALGYKGNWDPANNPHHLIRSEVSDINKAMGKIRALELKLKNGDWEGKTSYDWNLLNSLKREVGIPVEFPKDTKNLAGDGNIPSKAVAAHM
Ga0181562_1038220713300019459Salt MarshMAQNALGATPNWAPNTNPIHTIRSEVSDIYKAMTHIRMLENKLKNFDMNSGTTNADWNLLNSLKREIGINVEFGKDKSALAGPGNIASKTMASTQ
Ga0182044_111129013300020014Salt MarshMAQNALGATPNWAPNTNPIHTIRSEVSDIYKAMTHIRMLENKLKNFDMNSGTTNADWNLLNSLKREIGINVEFGKDKSALAGPGNIASKTMASTQXIDQ
Ga0206687_158271913300021169SeawaterMILSWNDWWLAHNALGHPTDWNPEQNPAHMVRSEVSDIYKAMTKIRALENKLKNWKGNGDTNADWNMLNSLKREVGIPVEFPGDTKTVLAGEGDIPAKAVAANM
Ga0206691_127596923300021342SeawaterLADPINGLLLSWNDWWLANNALGYQTKWDPENNPHHMIRSEVNDIYKAMSKIRMLEKKLTNESKNSGTTSYDWNLLNSLKREVGIPVEFSDEKEALAGDGNIPTKALSANM
Ga0206692_148869313300021350SeawaterMILSWNDWYMSQNGVGTPVEWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEFASDAKTVLSGDGGVPSKSVAAFS
Ga0213863_1021186323300021371SeawaterMILSWHDWWLAHNALGHPTDWNPEQNPAHMVRSEVNDIYKAMTKIRALENKLKNYKGNGDTNYDWNLLNSLKREVGIAVEFPGDNKTALAGEGDIPAKAVAANM
Ga0063132_11820323300021872MarineMILSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSA
Ga0063132_11948613300021872MarineMVYSWKDWYMANNILGAPTKWDPEHNPTHMVRSEVSDVYKAMSKIRALENRLKNSKLSGETNDDWNLLNSLKREVGIPVEFGDDKPALKGEGDIPSKAVTAFGEAYNGFXFI
Ga0222713_1050829013300021962Estuarine WaterLIVKLQDPVNGIMTSWNDWYLANNALGNEAKWDPDHNAHHMIRSEVNDIYKAMSKIRMLENKLRGQDSSGTTNFDWNLLNSLKREVGIPVEFANDKSALKGDGNIASKAMAANI
Ga0207956_104504813300025385FreshwaterMAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFNLNSGETNYDWNLLNSLKRELGIPVEFADDRKSLQGEGSIPTKTVVAFN
Ga0208107_106080213300025399FreshwaterMAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFNLNSGETNYDWNLLNSLKRELGIPVEFADDRKSLQGEGSIPTKTV
Ga0209405_117205513300025620Pelagic MarineMILSWNDWYMSQNGVGTPVEWDPKNNPSHMVRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEF
Ga0209198_113759113300025640Pelagic MarineMILSWNDWYMSQNGVGTPVEWDPKNNPSHMVRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEFASDAKTVLSGDGGVPSKSVAAFS
Ga0209715_117086213300025699Pelagic MarineMINNLQDPIHNMILSWNDWYMSQNGVGTPVPWAPATNPTHMIRSEVSDVYKAMTKIRALEKKLSKFDLNSGETNEDWNMLNSLKREIGIPVEFSGDAKTV
Ga0209305_117867823300025712Pelagic MarineMVLSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVP
Ga0208544_1027028613300025887AqueousMISKLQDPMNGLILSWNDWWMAHNALGHTGEWDPEGNPHHMVRSEVNDIYKAMTKIRALEAKLSKEDPNSGTTNFDWNMLNSLKREVGLPVEFGNDKKSLSGDGNIASKAIAANM
Ga0209335_1030665313300025894Pelagic MarineMISQLNNPIHGMILSWNDWWMAQNALGTPEKWSPATNPIHTIRSEVSDIYKAMTQIRMLENKLKNFDMNSGTTNADWNLLNSLKREVGINVEFGDDKKAQAGAGNIASKTMAATQ
Ga0209961_108806713300026130WaterMLLSWKDWFMAQNALGNPEKWSPETNPIHTIRSEVSDIYKAMTHIRMLENKLKNFDRNSGTTNADWNLLNSLKREIGINVEFGDDKSAQSGSGNIASKTMAANM
Ga0208275_106131823300026182MarineMLLSWYDWWLSQNALGVKDKWDPENNPAHMIRSEVSDIYKAMTKIRALENKVKKFDPNSGTTNQDWNLLNSLKRELGINVEFGDDKKA
Ga0247594_104896623300026448SeawaterMILSWNDWYMSQNALGAPEKWDPTHNPAHMIKAEVSDVQKAMMKIRALEMKLGKDTNSGTTNQDWSLLNSLKRELGINVEFGEDNSKKFAGDGSMAAKSVVANS
Ga0209617_1025495313300027720Freshwater And SedimentMILSWNDWYLAQNALGTPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEF
Ga0209085_137316313300027741Freshwater LakeMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNISTKTVVAFN
Ga0209084_133719413300027749Freshwater LakeMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGNISTKTTVAFN
Ga0209702_1034492523300027976FreshwaterLAHNALGNTASWDPVNNPHHMIRSEVNDINKAMVKIRALEAKLSREDLNSGTTNFDWNLLNSLKREVGIPVEFANDKHSLAGDGNISSKVIAAHL
Ga0256412_119685413300028137SeawaterLDQLLAANNDDEEWQQLTLSLISHLQDPIHNTILSWHDWFMSQNGVGAPEVGGWDPVKNPVHMIRSEVSDVYKAMTKIRMLEKKLAKSGQNSGTTNEDWNMLNSLKRELGIPVEFAAEKQQSLAGDGNVPTKATAAYM
Ga0256412_120646333300028137SeawaterMSQNALGAPEKWDPTHNPAHMIKAEVSDVQKAMMKIRALEMKLGKDTNSGTTNQDWSLLNSLKRELGINVEFGEDNSKKFAGDGSMAAKSVVANS
Ga0256413_129855413300028282SeawaterMINNLQDPIHNMVLSWNDWYMANNGVGTPVAWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDSATVLAGDGGVPSKSVA
Ga0247572_116203913300028290SeawaterLLAANDDKDENWEQLSLNLISHLQDPIHNTILSWNDWWMSQNAVGHPTTWDPVNNPFHLIKAEVSDVYKAMTKIRMLEKKLAKEGANSGTTNADWNMLNSLKRELGIPVEFAGDKA
Ga0307399_1038640723300030702MarineMILSWNDWWLAHNALGHPTDWSPETNPAHMVRSEVSDIYKAMTKIRALENKVKNYKGTGDTNADWNMLNSLKREVGIPVEFPGDTKTVLAGEGDIPSKAVA
Ga0307400_1051071913300030709MarineMILSWNDWYMSQNGVGTPTPWEPATNPSHMIRSEVSDVYKAMTKIRALEKKLSKFDMNSGSTNEDWNMLNSLKREIGIPVEFGEDKKTVLAGDGGVPSKSVAAFS
Ga0308128_103472913300030725MarineMINNLQDPVHNMILSWNDWYMANNGVGTPVSWDPKNNPSHMIRSEVSDVYKAMTKIRALERKLSKYDMNSGTTNEDWNMLNSLKREIGIPVEFAGDASTVLAGDGGVPSKSVAAFS
Ga0307386_1041661723300031710MarineMILSWNDWYNSQNGLGAAEKWDPDHNPAHMIRSEVSDVYKAMSKIRALESKVAKFDKNSGTTNGDWNLLNSLKRELGINVEFGDDKKALAGDGSVPAKSTVAFS
Ga0307386_1058247313300031710MarineMVLSWNDWWLAHNALGVPVKWEPERNPNQMVRSEVNDVYKAMTKIRALENKLKNYKGQGDTNYDWNLLNSLKREVGIAVEFPGDNAKNLAGEGDVTSKAVVANM
Ga0307386_1070539633300031710MarineMHNMILSWNDWWMSQNGMAANTDKWDPAQNPQHMVRSEVSDIYKAMTKIRMLENKLKKFDMNSGKTNADWNMLNSLKRELGINVEFADDKSA
Ga0307381_1024063133300031725MarineMHNMILSWNDWWMTQNGMAANTDKWDPAQNPQHMVRSEVSDIYKAMTKIRMLENKLKKFDMNSGKTNADWNMLNSLKRELGINVEFADDKSA
Ga0307397_1047076913300031734MarineMILSWNDWWLAHNALGHPTDWSPETNPAHMVRSEVSDIYKAMTKIRALENKVKNYKGTGDTNADWNMLNSLKREVGIPVEFPGDTKT
Ga0307394_1044793633300031735MarineMHNMILSWNDWWMTQNGMAANTDKWDPATNPQHMVRSEVSDIYKAMTKVRMLENKLKKFDMNSGKTNADWNMLNSLKRELGINVEFADDK
Ga0307384_1056682233300031738MarineMHNMILSWNDWWMTQNGMAANTDKWDPATNPQHMVRSEVSDIYKAMTKVRMLENKLKKFDMNSGKTNADWNMLNSLKRELGINVEFADDKSA
Ga0307383_1055165113300031739MarineMVLSWNDWWLSHNALGYPIKWDPEHNPQHMVRSEVNDIYKAMTKIRALENKLKNYKGQGDTNYDWNLLNSLKREVGIAVEFPSDNDKNLAGAGDVTSK
Ga0314677_1062856913300032522SeawaterMILSWNDWYMSQNGVGTPVEWDPKNNPSHMVRSEVSDVYKAMTKIRALERKLSKYDMNSGETNQDWNMLNSLKREVGIPVEFASDA
Ga0335005_0363173_407_7213300034022FreshwaterMILSWNDWYLAQNALGAPIKWDPVGNPTHMIRGEISDVYKAMTKIRALEKKLKNFDLNSGQTNYDWNLLNSLKRELGIPVEFADDRKSLQGEGSIPTKTVVAFN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.