NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087172

Metagenome / Metatranscriptome Family F087172

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087172
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 99 residues
Representative Sequence MDNFDLKKYLAEGRLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYKDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVEK
Number of Associated Samples 102
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.73 %
% of genes near scaffold ends (potentially truncated) 30.91 %
% of genes from short scaffolds (< 2000 bps) 77.27 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (71.818 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(15.454 % of family members)
Environment Ontology (ENVO) Unclassified
(62.727 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.00%    β-sheet: 16.80%    Coil/Unstructured: 55.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF07992Pyr_redox_2 3.64
PF03237Terminase_6N 3.64
PF07230Portal_Gp20 2.73
PF05728UPF0227 1.82
PF02562PhoH 0.91
PF06414Zeta_toxin 0.91
PF03420Peptidase_S77 0.91
PF16861Carbam_trans_C 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 0.91
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A71.82 %
All OrganismsrootAll Organisms28.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573027|GS312G0146KB_1118463115099All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium912Open in IMG/M
3300000116|DelMOSpr2010_c10033642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_772373Open in IMG/M
3300000265|LP_A_09_P04_10DRAFT_1004376All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium3670Open in IMG/M
3300001460|JGI24003J15210_10057937Not Available1261Open in IMG/M
3300001938|GOS2221_1005681All Organisms → Viruses → Predicted Viral1578Open in IMG/M
3300004279|Ga0066605_10013794Not Available4220Open in IMG/M
3300004279|Ga0066605_10106478All Organisms → Viruses → Predicted Viral1158Open in IMG/M
3300004642|Ga0066612_1044379Not Available953Open in IMG/M
3300005239|Ga0073579_1178037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium7753Open in IMG/M
3300005942|Ga0070742_10021616Not Available1708Open in IMG/M
3300006484|Ga0070744_10245482Not Available507Open in IMG/M
3300006749|Ga0098042_1160218Not Available548Open in IMG/M
3300006752|Ga0098048_1017152All Organisms → Viruses → Predicted Viral2463Open in IMG/M
3300006802|Ga0070749_10258726Not Available984Open in IMG/M
3300006810|Ga0070754_10086468Not Available1571Open in IMG/M
3300006919|Ga0070746_10062354Not Available1920Open in IMG/M
3300006919|Ga0070746_10311230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium721Open in IMG/M
3300006924|Ga0098051_1006161Not Available3847Open in IMG/M
3300007539|Ga0099849_1027999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2420Open in IMG/M
3300007540|Ga0099847_1000417Not Available14500Open in IMG/M
3300007540|Ga0099847_1108100Not Available844Open in IMG/M
3300007554|Ga0102820_1049944All Organisms → Viruses → Predicted Viral1015Open in IMG/M
3300007555|Ga0102817_1024378Not Available1338Open in IMG/M
3300007640|Ga0070751_1219434Not Available732Open in IMG/M
3300008999|Ga0102816_1051450Not Available1225Open in IMG/M
3300009001|Ga0102963_1029953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.2276Open in IMG/M
3300009003|Ga0102813_1133193Not Available781Open in IMG/M
3300009024|Ga0102811_1119344Not Available987Open in IMG/M
3300009026|Ga0102829_1326266Not Available514Open in IMG/M
3300009052|Ga0102886_1128937Not Available760Open in IMG/M
3300009059|Ga0102830_1222415Not Available552Open in IMG/M
3300009420|Ga0114994_10070517Not Available2389Open in IMG/M
3300009435|Ga0115546_1340376Not Available510Open in IMG/M
3300009436|Ga0115008_10951524Not Available638Open in IMG/M
3300009526|Ga0115004_10827082Not Available552Open in IMG/M
3300009599|Ga0115103_1170046Not Available832Open in IMG/M
3300009705|Ga0115000_10371603Not Available915Open in IMG/M
3300009785|Ga0115001_10251841Not Available1130Open in IMG/M
3300010148|Ga0098043_1141536Not Available685Open in IMG/M
3300010297|Ga0129345_1292096Not Available565Open in IMG/M
3300010300|Ga0129351_1230359Not Available712Open in IMG/M
3300012954|Ga0163111_11599203Not Available647Open in IMG/M
3300013098|Ga0164320_10134248Not Available1100Open in IMG/M
3300013099|Ga0164315_10487475All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium998Open in IMG/M
3300017706|Ga0181377_1025645Not Available1256Open in IMG/M
3300017706|Ga0181377_1037492Not Available972Open in IMG/M
3300017713|Ga0181391_1007485All Organisms → cellular organisms → Bacteria2873Open in IMG/M
3300017714|Ga0181412_1037474Not Available1276Open in IMG/M
3300017727|Ga0181401_1095963Not Available758Open in IMG/M
3300017728|Ga0181419_1027505All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1567Open in IMG/M
3300017741|Ga0181421_1051886All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1090Open in IMG/M
3300017742|Ga0181399_1002824All Organisms → cellular organisms → Bacteria → Proteobacteria5712Open in IMG/M
3300017751|Ga0187219_1063906Not Available1183Open in IMG/M
3300017752|Ga0181400_1078535All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300017770|Ga0187217_1294744Not Available523Open in IMG/M
3300017773|Ga0181386_1221491Not Available564Open in IMG/M
3300017781|Ga0181423_1086983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1231Open in IMG/M
3300017818|Ga0181565_10113597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1911Open in IMG/M
3300017956|Ga0181580_10118813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM21920Open in IMG/M
3300017985|Ga0181576_10093807Not Available2021Open in IMG/M
3300017985|Ga0181576_10112447Not Available1826Open in IMG/M
3300018048|Ga0181606_10254324Not Available991Open in IMG/M
3300018416|Ga0181553_10477525Not Available668Open in IMG/M
3300020404|Ga0211659_10353035Not Available642Open in IMG/M
3300021085|Ga0206677_10068067Not Available1775Open in IMG/M
3300021169|Ga0206687_1108738All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes8178Open in IMG/M
3300021373|Ga0213865_10074312All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1847Open in IMG/M
3300021375|Ga0213869_10182152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77958Open in IMG/M
3300021957|Ga0222717_10000728Not Available28098Open in IMG/M
3300022200|Ga0196901_1282786Not Available505Open in IMG/M
(restricted) 3300022920|Ga0233426_10002747Not Available14409Open in IMG/M
3300022939|Ga0255754_10100650Not Available1580Open in IMG/M
(restricted) 3300023109|Ga0233432_10048476Not Available2702Open in IMG/M
(restricted) 3300023109|Ga0233432_10106290Not Available1565Open in IMG/M
(restricted) 3300023112|Ga0233411_10255970All Organisms → Viruses583Open in IMG/M
3300023178|Ga0255759_10052172Not Available3029Open in IMG/M
(restricted) 3300023276|Ga0233410_10021561Not Available1825Open in IMG/M
3300023698|Ga0228682_1023893Not Available818Open in IMG/M
3300023699|Ga0228695_1032159Not Available740Open in IMG/M
3300024231|Ga0233399_1064340All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium920Open in IMG/M
(restricted) 3300024255|Ga0233438_10076540Not Available1596Open in IMG/M
(restricted) 3300024255|Ga0233438_10137138Not Available1066Open in IMG/M
(restricted) 3300024264|Ga0233444_10000203Not Available83484Open in IMG/M
(restricted) 3300024264|Ga0233444_10094515Not Available1584Open in IMG/M
(restricted) 3300024324|Ga0233443_1300458Not Available532Open in IMG/M
3300025098|Ga0208434_1000511Not Available18114Open in IMG/M
3300025120|Ga0209535_1002899All Organisms → cellular organisms → Bacteria11140Open in IMG/M
3300025543|Ga0208303_1000001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales111989Open in IMG/M
3300025590|Ga0209195_1116839Not Available573Open in IMG/M
3300025608|Ga0209654_1123696Not Available659Open in IMG/M
3300025671|Ga0208898_1132516Not Available700Open in IMG/M
3300025727|Ga0209047_1212852Not Available575Open in IMG/M
3300025767|Ga0209137_1170335Not Available767Open in IMG/M
3300025769|Ga0208767_1243030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium569Open in IMG/M
3300025770|Ga0209362_1080366All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1268Open in IMG/M
3300025853|Ga0208645_1166611Not Available818Open in IMG/M
3300026187|Ga0209929_1114244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.688Open in IMG/M
3300027186|Ga0208797_1027305Not Available752Open in IMG/M
3300027525|Ga0208437_1076352Not Available783Open in IMG/M
3300027753|Ga0208305_10049073Not Available1641Open in IMG/M
3300027813|Ga0209090_10060483Not Available2105Open in IMG/M
3300027833|Ga0209092_10651486Not Available521Open in IMG/M
3300028125|Ga0256368_1003895Not Available2233Open in IMG/M
3300028126|Ga0228648_1089659Not Available589Open in IMG/M
3300028134|Ga0256411_1201081Not Available630Open in IMG/M
3300028189|Ga0257127_1131165Not Available705Open in IMG/M
3300028233|Ga0256417_1057209Not Available1055Open in IMG/M
3300028282|Ga0256413_1001228All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium5307Open in IMG/M
3300028337|Ga0247579_1096247Not Available580Open in IMG/M
3300031851|Ga0315320_10942925Not Available527Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.45%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.82%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater10.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater9.09%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.09%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.27%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.55%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.64%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.82%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.82%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.82%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.82%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.82%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.82%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.91%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.91%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.91%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.91%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine0.91%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.91%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.91%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573027Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmaxEnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000265Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001938Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005EnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004642Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022939Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023699Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024324 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MGEnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025590Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025727Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025770Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028126Seawater microbial communities from Monterey Bay, California, United States - 60DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028189Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135mEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028337Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 38R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GS312G0146KB_003752302189573027Marine EstuarineMNNFDLRKFLKENKLTTNSKLVKEEVDYHIELLVPKVAFDVESGELADSLYEFGTEDEIKNGVVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK
DelMOSpr2010_1003364233300000116MarineMDNFDLRKYLAEGRLLKEEMDYHIELLTPEIAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEYPGLFKVVVK*
LP_A_09_P04_10DRAFT_100437643300000265MarineMKDNFNLRTFLTENKLTQKSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ*
JGI24003J15210_1005793723300001460MarineMDNFDLKKYLAEGRLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYKDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVEK*
GOS2221_100568123300001938MarineMKDNFNLRKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYKFATEDEIESGEADVTTYTDGDELDEWVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0066605_1001379413300004279MarineTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ*
Ga0066605_1010647813300004279MarineTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEWVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0066612_104437923300004642MarineMDNFDLKKYLAEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYPNLIKIK*
Ga0073579_117803743300005239MarineMKNNFDLKKFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0070742_1002161633300005942EstuarineMKDNFNLRKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ*
Ga0070744_1024548223300006484EstuarineMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYPNLIKIK*
Ga0098042_116021823300006749MarineSNSKLVKEEVDYHIELLTPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFGRSYKQAKHFEKQYPGLFKVVVK*
Ga0098048_101715223300006752MarineMNNFNLRKFLTENKLTTNSKLLKEEINYSVELLVPEVAFNVESGDLADSPYEFGTEDEIENEEVDVTTYTDGDELDEFVFGRSYKQAKHFEKEYPGLFKVIEK*
Ga0070749_1025872623300006802AqueousMDNFDLKKYLAEGRLLKEEIDYYIKLLVPEIAFNVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKKYPGLFKVVVK*
Ga0070754_1008646823300006810AqueousMDDFDLKKYLAEGRLIKEEINYQIELLVPEVAFNVESGELADSPYEFATEDEIENGEADVTTYTDGDELDEWVFGRNYDNALDFAKRYPNLIKINKKR*
Ga0070746_1006235423300006919AqueousMDNFDLKKYLAEGRLIKEEINYQIELLVPEVAFNVESGELADSPYEFATEDEIENGEADVTTYTDGDELDEWVFGRNYDNALDFAKRYPNLIKINKKR*
Ga0070746_1031123023300006919AqueousMNNFDLKKYLAEGRLFEEEVDYHIELLTPEIAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEYPGLFKVVVK*
Ga0098051_100616143300006924MarineMNNFNLRKFLTENKLTTNSKLLKEEINYSVELLVPEVAFDVESGDLADSPYEFGTEDEIENEEVDVTTYTDGDELDEFVFGRSYKQAKHFEKQYPGLFKVIEK*
Ga0099849_102799933300007539AqueousMKSNFDLRKFLVENKLTSNSRLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFDRSYEQAKHFEKEYPGLFKVVVK*
Ga0099847_100041723300007540AqueousMNNFNLKKYLAEGRLFEEEVDYHIELLTPEIAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEHPGLFKVIVK*
Ga0099847_110810023300007540AqueousMENNFDLKKFLVENKLTSNSKLIKEEVDYHIELLVPEVAFDVESGALADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFGRSYKQAKYFEKEYPGLFKVVVK*
Ga0102820_104994423300007554EstuarineMNNFDLRKFLKENKLTTNSKLVKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0102817_102437813300007555EstuarineMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVF
Ga0070751_121943413300007640AqueousEGRLIKEEINYQIELLVPEVAFNVESGELADSPYEFATEDEIENGEADVTTYTDGDELDEWVFGRNYDNALDFAKRYPNLIKINKKR*
Ga0102816_105145023300008999EstuarineMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0102963_102995343300009001Pond WaterMSFDLRKYLAEGRLLKEEVNYHIELLAPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFNRSYDQAKHFEKLHPGLFKVVEK*
Ga0102813_113319333300009003EstuarineMDNFDLKKYLAEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKHFEKSHPGLFKVVEK*
Ga0102811_111934423300009024EstuarineMKDNFNLRKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEWVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0102829_132626623300009026EstuarineFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ*
Ga0102886_112893723300009052EstuarineMKDNFNLRKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYPNLIKLK*
Ga0102830_122241513300009059EstuarineMNNFDLRKFLKENKLTTNSKLVKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYPNLIKIK*
Ga0114994_1007051723300009420MarineMKDNFNLRTFLIENKLTQNSRVLKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0115546_134037613300009435Pelagic MarineKAKEIFDEYLEDLKAEQPDAFDFFMKDLAEGKLLKEEVNYHIELLTPEIAFNVESGKLADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEHPGLFKVVIK*
Ga0115008_1095152423300009436MarineMKELYKFRQFLNEEVNYSVELLVPEVAFDVESGELADSPYEFGTEEEIEDGEVDVTTYEDGDELDEYVFGRSYEQALDFAKRYPNLIKIK*
Ga0115004_1082708213300009526MarineMKNNFDLKKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0115103_117004623300009599MarineMKDNFNLRAFLIENKLTQNSRALKEEVDYHIELLVPKVAFDVESGDLADSPYEFGTEDEIKNGEVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK*
Ga0115000_1037160323300009705MarineMKDNFNLRTFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0115001_1025184123300009785MarineNKMKDNFNLRTFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ*
Ga0098043_114153613300010148MarineMDNFDLKKYLAEGRLLKEEINYSVELLVPEVAFDVESGDLADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFGRSYKQAKHFEKQYPGLFKVIEK*
Ga0129345_129209613300010297Freshwater To Marine Saline GradientSNFDLRKFLVENKLTSNSRLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFDRSYEQAKHFEKEYPGLFKVVVK*
Ga0129351_123035923300010300Freshwater To Marine Saline GradientLTSNSKLVKEEVNYHIELLVPQVAFDVESGELADTPYAFATEDEIESGEADVTTYTDGDELDEWVFGRSYENAKHFEKEYPGLFKVVVK*
Ga0163111_1159920323300012954Surface SeawaterMDNFDLKKYLAEGRLLKEEINYSVELLVPEVAFDVKSGDLADSPYEFGTEDEIKDGEVDITTYTDGDELDEFVFGRSYKQAKYFEKQYPGLFKVIEK*
Ga0164320_1013424833300013098Marine SedimentMDNFDLRKYLAEGRLLKEEVDYEIELLVPKVAFDVESGELADSPYAFATADEIESGEADVTTYTDGDELDEWVFDRSYENAKRFEKEHPGLFKIKIN*
Ga0164315_1048747523300013099Marine SedimentMDNFDLRKYLAEGRLLKEEVDYEIELLVPKVAFDVESGELADSPYAFATADEIESGEADVTTYTDGDELDEWVFDRSYENAKRFEKEHPGLFKIKING*
Ga0181377_102564523300017706MarineMDNFDLRKYLAEGKLLKEEINYSVELLVPEVAFNVESGELADSPYEFGTEDEIEDGEVDVTTYNDGDELDEFIFSRDYKTAKNFAKRYPNLIKIK
Ga0181377_103749223300017706MarineMDNFDLKKYLAESRLLKEEVDYHIELLAPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFGRSYEQAKRFEKLHPGLFKVVEK
Ga0181391_100748533300017713SeawaterMENFDFKKYLTEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKYFEKEYPGLFKVVEK
Ga0181412_103747413300017714SeawaterEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIENGEADVTTYTDGDELDEFVFGRSYDQAKHFEKSHPGLFKVVEK
Ga0181401_109596323300017727SeawaterMENFDLKKYLTESRLLKEEVNYHIELLVPEVAFDVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKYFEKEYPGLFKVVEK
Ga0181419_102750533300017728SeawaterMDNFDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKYFEKEYPGLFKVVEK
Ga0181421_105188623300017741SeawaterMDNFDLKKYLAESRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKHFEKLHPSLFKVVEK
Ga0181399_100282433300017742SeawaterMKNNFNLRTFLTENKLTQNSRTLKEEVDYHIELLVPQVAFNVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFSRSYKQAKYFEEAFPGLFKVIVK
Ga0187219_106390623300017751SeawaterMKDNFNLRAFLIENKLTQNSRALKEEVDYHIELLVPKVAFDVESGDLADSPYEFGTEDEIKDGEVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK
Ga0181400_107853513300017752SeawaterMENFDFKKYLTEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQA
Ga0187217_129474413300017770SeawaterMENFDFKKYLTEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKHFEKLHPSLFKVVEK
Ga0181386_122149123300017773SeawaterMKDNFNLRTFLSENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYKQALHFAKEYPHLLKINTRQ
Ga0181423_108698333300017781SeawaterMDNFDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKHFEKSQPGLFKVVEK
Ga0181565_1011359723300017818Salt MarshMADNFDLKKFLIENKITSNSRLLKEEVDYHIELLVPEVASDVESGELADTPYAFATEDEIESGEADVTTYTDGDELDEWVFGRSYENAKHFEKEYPGLFKVVVK
Ga0181580_1011881333300017956Salt MarshMNNFNLKKYLVEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKFFEKEYPGLFKVVV
Ga0181576_1009380723300017985Salt MarshMENFNLKKYLVEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKFFEKEYPGLFKVVV
Ga0181576_1011244723300017985Salt MarshMADNFDLKKFLIENKITSNSRLLKEEVDYHIELLVPEVAFDVESGELADTPYAFATEDEIESGEADVTTYTDGDELDEWVFGRSYENAKHFEKEYPGLFKVVVK
Ga0181606_1025432423300018048Salt MarshSKLVKEEVNYHIELLVSQVAFDVESGELADTPYAFATEDEIESGEADVTTYTDGDELDEWVFGRSYENAKHFEKEYPGLFKVVVK
Ga0181553_1047752523300018416Salt MarshMENNFDLRNFLTENKLTSNSKLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFDRSYEKLNISKKNTQVYSK
Ga0211659_1035303523300020404MarineMESNFDLRKFLTENKLTSNSKLVKEEVDYHIELLTPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFGRSYKQAKHFEKQYPGLFKVVVK
Ga0206677_1006806723300021085SeawaterMKDNFNLRTFLSENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYKQALHFAKEYPHLIKINTRQ
Ga0206687_110873843300021169SeawaterMDNFDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKHFEKLHPSLFKVVEK
Ga0213865_1007431233300021373SeawaterMENNFDLRNFLTENKLTSNSKLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFDRSYEQAKHFEKEYPGLFKVVVN
Ga0213869_1018215223300021375SeawaterMDNFDLRKYLAEGRLLKEEMDYHIELLTPEIAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEYPGLFKVVVK
Ga0222717_1000072823300021957Estuarine WaterMKDNFNLRAFLIENKLTQNSRALKEEVDYHIELLVPKVAFDVESGDLADSPYEFGTEDEIKNGEVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK
Ga0196901_128278623300022200AqueousSNFDLRKFLVENKLTSNSRLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFDRSYEQAKHFEKEYPGLFKVVVK
(restricted) Ga0233426_1000274753300022920SeawaterMNQSILKNQPKNLKHNNNKMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
Ga0255754_1010065013300022939Salt MarshRRRTRSIIFIIIIKNMADNFDLKKFLIENKITSNSRLLKEEVDYHIELLVPEVAFDVESGELADTPYAFATEDEIESGEADVTTYTDGDELDEWVFGRSYENAKHFEKEYPGLFKVVVK
(restricted) Ga0233432_1004847633300023109SeawaterMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTAYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ
(restricted) Ga0233432_1010629043300023109SeawaterMDNFDLKKYLAEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYPNLIKI
(restricted) Ga0233411_1025597013300023112SeawaterMDNFDLKKYLAEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYP
Ga0255759_1005217233300023178Salt MarshLRDNKITSNSRLLKEEVDYHIELLVPEVAFDVESGELADTPYAFATEDEIESGEADVTTYTDGDELDEWVFGRSYENAKHFEKEYPGLFKVVVK
(restricted) Ga0233410_1002156123300023276SeawaterMDNFDLKKYLAEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALDFAKRYPNLIKIK
Ga0228682_102389323300023698SeawaterMKDNFNLRAFLIENKLTQNSRALKEEVDYHIELLVPKVAFDVESGELADSPYEFGTEDEIKNGVVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK
Ga0228695_103215923300023699SeawaterDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFVTKDEIENGEADVTTYTDGDELDEFVFGRSYDQAKHFEKSHPGLFKVVEK
Ga0233399_106434033300024231SeawaterMDNFDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIESGEADVTTYTDGDELDEFVFGRSYDQAKHFEKSHPGLFKVVEK
(restricted) Ga0233438_1007654013300024255SeawaterMDNFDLKKYLAEGRLLKEEVNYHIELLVPEVAFDVESGELADSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQAL
(restricted) Ga0233438_1013713813300024255SeawaterMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYP
(restricted) Ga0233444_10000203833300024264SeawaterMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ
(restricted) Ga0233444_1009451513300024264SeawaterKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTIYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
(restricted) Ga0233443_130045823300024324SeawaterLKHNNNKMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ
Ga0208434_1000511193300025098MarineMNNFNLRKFLTENKLTTNSKLLKEEINYSVELLVPEVAFNVESGDLADSPYEFGTEDEIENEEVDVTTYTDGDELDEFVFGRSYKQAKHFEKEYPGLFKVIEK
Ga0209535_100289923300025120MarineMDNFDLKKYLAEGRLLKEEVDYHIELLVPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYKDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVEK
Ga0208303_1000001823300025543AqueousMNNFNLKKYLAEGRLFEEEVDYHIELLTPEIAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEHPGLFKVIVK
Ga0209195_111683913300025590Pelagic MarineKAIGKEEVNYHIELLTPEITFNVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEHPGLFKVVIK
Ga0209654_112369613300025608MarineMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
Ga0208898_113251623300025671AqueousMDNFDLKKYLAEGRLIKEEINYQIELLVPEVAFNVESGELADSPYEFATEDEIENGEADVTTYTDGDELDEWVFGRNYDNALDFAKRYPNLIKINKKR
Ga0209047_121285213300025727MarineRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
Ga0209137_117033513300025767MarineNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTIYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
Ga0208767_124303013300025769AqueousMNNFDLKKYLAEGRLFEEEVDYHIELLTPEIAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDADELDEFVFGRSYNQAKYFEKEYPGL
Ga0209362_108036613300025770MarineMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTIYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
Ga0208645_116661123300025853AqueousMDDFDLKKYLAEGRLIKEEINYQIELLVPEVAFNVESGELADSPYEFATEDEIENGEADVTTYTDGDELDEWVFGRNYDNALDFAKRYPNLIKINKKR
Ga0209929_111424423300026187Pond WaterMSFDLRKYLAEGRLLKEEVNYHIELLAPEVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEFVFNRSYDQAKHFE
Ga0208797_102730513300027186EstuarineEAKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFSRSYEQALHFAKEYPHLIKINTRQ
Ga0208437_107635223300027525EstuarineMKDNFNLRKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEWVFGRSYEQALHFAKEYPHLIKINTRQ
Ga0208305_1004907343300027753EstuarineMKDNFNLRKFLIENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGR
Ga0209090_1006048333300027813MarineMKDNFNLRTFLIENKLTQNSRVLKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQALHFAKEYPHLIKINTRQ
Ga0209092_1065148613300027833MarineMKELYKFRQFLNEEVNYSVELLVPEVAFDVESGELADSPYEFGTEEEIEDGEVDVTTYEDGDELDEYVFGRSYEQALDFAKRYPNLIKIK
Ga0256368_100389533300028125Sea-Ice BrineMNNFDLRKYLAEGRLIKEEINYQIELLVPEVAFNVESGELADSPYEFATEDEIENGEADVTTYTDGDELDEWVFGRNYDNALDFAKRYPNLIKINKKR
Ga0228648_108965913300028126SeawaterMNNFDLRKFLKENKLTTNSKLVKEEVDYHIELLVPKVAFDVESGELADSPYEFGTEDEIEDGEVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVV
Ga0256411_120108113300028134SeawaterNMKDNFNLRTFLSENKLTQNSRALKEEVDYHIELLVPKVAFDVESGDLADSPYEFGTEDEIKNGEVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK
Ga0257127_113116513300028189MarineMKDNFNLRTFLTENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYEQAL
Ga0256417_105720933300028233SeawaterMDNFDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIENGEADVTTYTDGDELDEFVFGRSYDQAKHFEKLHPSLFKVVEKQK
Ga0256413_100122823300028282SeawaterMKDNFNLRAFLIENKLTQNSRALKEEVDYHIELLVPKVTFDVESGDLADSPYEFGTEDEIKNGEVDVTTYTDGDELDEWVFGRSYKQAKHFEKEYPGLFKVVVK
Ga0247579_109624713300028337SeawaterMDNFDLKKYLAEGRLLKEEVDYHIELLVPQVAFEVESGELADSPYAFATKDEIENGEADVTTYTDGDELDEFVFGRSYDQAKHFEKSHPGLFKVVEK
Ga0315320_1094292523300031851SeawaterMKDNFNLRTFLSENKLTQNSRALKEEVDYSIELLVPEVAFDVESGEMSDSPYEFATEDEIESGEADVTTYTDGDELDEYVFGRSYKQALHFAKEYPHLIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.