NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087085

Metagenome / Metatranscriptome Family F087085

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087085
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 86 residues
Representative Sequence MLKDNSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGTGMDLCMNHFSDMVRSIHRSGESELNANN
Number of Associated Samples 92
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 20.91 %
% of genes near scaffold ends (potentially truncated) 12.73 %
% of genes from short scaffolds (< 2000 bps) 98.18 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(11.818 % of family members)
Environment Ontology (ENVO) Unclassified
(38.182 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(57.273 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.55%    β-sheet: 0.00%    Coil/Unstructured: 50.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
c.23.5.2: Cytochrome p450 reductase N-terminal domain-liked1tlla21tll0.6038
c.23.5.0: automated matchesd3qe2a13qe20.59692
d.198.3.1: YjbR-liked2fkia12fki0.58538
a.133.1.2: Vertebrate phospholipase A2d2g58a_2g580.58501
e.79.1.1: CRISPR associated protein Cas1-liked2yzsa_2yzs0.58246


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002186|JGI24539J26755_10147125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300003216|JGI26079J46598_1104559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
3300004095|Ga0007829_10119404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300005069|Ga0071350_1238427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300005988|Ga0075160_10518877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300006108|Ga0007862_1093261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea569Open in IMG/M
3300006115|Ga0007816_1075085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea751Open in IMG/M
3300006641|Ga0075471_10432082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300006803|Ga0075467_10456913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea660Open in IMG/M
3300006803|Ga0075467_10499801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea626Open in IMG/M
3300006803|Ga0075467_10589171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300006805|Ga0075464_10163475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1312Open in IMG/M
3300007231|Ga0075469_10221397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300007513|Ga0105019_1190888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1023Open in IMG/M
3300007551|Ga0102881_1186397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300007552|Ga0102818_1066404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300007600|Ga0102920_1263310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300007661|Ga0102866_1180866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300007725|Ga0102951_1177746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300008052|Ga0102893_1167576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300008929|Ga0103732_1057631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300009001|Ga0102963_1427913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300009071|Ga0115566_10655031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300009071|Ga0115566_10726835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300009159|Ga0114978_10311777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea961Open in IMG/M
3300009422|Ga0114998_10322387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea723Open in IMG/M
3300009434|Ga0115562_1232120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300009436|Ga0115008_10273565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1200Open in IMG/M
3300009438|Ga0115559_1273330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300009441|Ga0115007_10050388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2604Open in IMG/M
3300009441|Ga0115007_10928097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300009497|Ga0115569_10306928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea699Open in IMG/M
3300009543|Ga0115099_10216718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea522Open in IMG/M
3300009599|Ga0115103_1302368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300009599|Ga0115103_1822169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300009606|Ga0115102_10649596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300010392|Ga0118731_111477465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea509Open in IMG/M
3300010430|Ga0118733_107491072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300012518|Ga0129349_1255282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea518Open in IMG/M
3300012954|Ga0163111_10791623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea902Open in IMG/M
3300013014|Ga0164295_10655450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea810Open in IMG/M
3300013296|Ga0157374_11327457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea741Open in IMG/M
3300013306|Ga0163162_10646560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1181Open in IMG/M
3300017788|Ga0169931_10688393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea675Open in IMG/M
3300017957|Ga0181571_10647619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300018420|Ga0181563_10538765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea653Open in IMG/M
3300018420|Ga0181563_10721976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300018420|Ga0181563_10722361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea549Open in IMG/M
3300018974|Ga0192873_10419010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300018974|Ga0192873_10433654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300018980|Ga0192961_10217303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300019035|Ga0192875_10178357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300019036|Ga0192945_10220327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea606Open in IMG/M
3300019048|Ga0192981_10311902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea583Open in IMG/M
3300019048|Ga0192981_10333539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea556Open in IMG/M
3300019050|Ga0192966_10227712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300019108|Ga0192972_1082802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300020074|Ga0194113_10928158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea586Open in IMG/M
3300020146|Ga0196977_1098897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea676Open in IMG/M
3300020146|Ga0196977_1105238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea652Open in IMG/M
3300020183|Ga0194115_10415606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300021067|Ga0196978_1069687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea669Open in IMG/M
3300021142|Ga0214192_1162825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea559Open in IMG/M
3300021336|Ga0210307_1177635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea586Open in IMG/M
3300021353|Ga0206693_1835007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea505Open in IMG/M
3300021365|Ga0206123_10312765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300021887|Ga0063105_1005373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea505Open in IMG/M
3300023176|Ga0255772_10608284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300024343|Ga0244777_10476520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea769Open in IMG/M
3300024346|Ga0244775_11440933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300025426|Ga0208739_1050828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300025487|Ga0208105_1044921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea793Open in IMG/M
3300025872|Ga0208783_10286782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300025887|Ga0208544_10051710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1983Open in IMG/M
3300025887|Ga0208544_10284694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300025887|Ga0208544_10337112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea577Open in IMG/M
3300025890|Ga0209631_10339935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea713Open in IMG/M
3300025890|Ga0209631_10361940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300025896|Ga0208916_10415303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300025897|Ga0209425_10351343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300027159|Ga0208020_1057366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea717Open in IMG/M
3300027810|Ga0209302_10220023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea903Open in IMG/M
3300027810|Ga0209302_10422177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300027833|Ga0209092_10038758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea3016Open in IMG/M
3300028335|Ga0247566_1081227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300029955|Ga0311342_11112876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300030564|Ga0210256_10289597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300030624|Ga0210251_10006951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300030625|Ga0210259_10176668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300030632|Ga0210250_11297000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300030738|Ga0265462_12209596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300030741|Ga0265459_13696863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300030741|Ga0265459_13938500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea521Open in IMG/M
3300030741|Ga0265459_14258035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea502Open in IMG/M
3300030778|Ga0075398_10416630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea500Open in IMG/M
3300030859|Ga0073963_10915925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea553Open in IMG/M
3300030979|Ga0068589_10317088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300031211|Ga0307974_1070238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1486Open in IMG/M
3300031221|Ga0307948_1058052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1677Open in IMG/M
3300031231|Ga0170824_103992489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia506Open in IMG/M
3300031231|Ga0170824_106806259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300031231|Ga0170824_123448820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300031569|Ga0307489_10936417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea616Open in IMG/M
3300031638|Ga0302125_10168235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea690Open in IMG/M
3300031684|Ga0307946_1096383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea867Open in IMG/M
3300031729|Ga0307391_10922073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300031752|Ga0307404_10503367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300031758|Ga0315907_11122596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300032275|Ga0315270_10747596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea641Open in IMG/M
3300032517|Ga0314688_10099410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1318Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.82%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.82%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.09%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater5.45%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.55%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.55%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.73%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.73%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil2.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.91%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.91%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.91%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.91%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.91%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.91%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.91%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.91%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.91%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.91%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.91%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.91%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.91%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.91%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.91%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.91%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300005069Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024EnvironmentalOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006115Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300021067Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20-13CEnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025426Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025487Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031211Saline water microbial communities from Organic Lake, Antarctica - #784EnvironmentalOpen in IMG/M
3300031221Saline water microbial communities from Organic Lake, Antarctica - #280EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031684Saline water microbial communities from Organic Lake, Antarctica - #230EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24539J26755_1014712523300002186MarineMLQAGSDNFLACKEPIDGMWRCYTEEKYGQSIRNAPAYTKPYEKKFYDCLFREASGLDLCMNNFTNMIRSIHRSGESTLNTQF*
JGI26079J46598_110455923300003216MarineVCHTTMLKEKSDNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKLYQCLWREGSGLDLCMNHFSDMVRSIHRSGESTLNDKN*
Ga0007829_1011940413300004095FreshwaterMLKDNASNFLACKAPLDGMWRCYTEEKYGQSIRDAPDYAKKYEKNLYDCLFREGSGMDICQPHFSNMIRAVYRSGDNKLNDKY*
Ga0071350_123842713300005069FreshwaterMLQAGSDNFLACKQPIDAMWRCYTEDKYGASIRDAPEYTKPYEAKFYDCLFRDATGLDICMKNFSNMIRSIHRSGESQLNTNF*
Ga0075160_1051887713300005988Wastewater EffluentMLLQNADNFLACKEPIDSMWRCYTEEKYGNSIRDAPEYTKQHESRFYDCLFRDASGLDVCMQHFSGMVRKIHRSGESTLNTNF*
Ga0007862_109326123300006108FreshwaterMNKDKADNFLACKEPIDGMWSCYTEGKYGSSIRDAPAFAKPYEKKFYNCLFREATGMDVCMSHFSDMVRAIYRSPENELCDWN*
Ga0007816_107508523300006115FreshwaterMLKDNASNFLACKAPLDGMWRCYTEEKYGQSIRDAPDYAKKYEKNLYDCLFREGSGMDICQPHFSNMIRAVYRSGDNKLNDKY*LLYL*
Ga0075471_1043208213300006641AqueousVCHAQMIEQNSNNFLACKQPIDGMWRCFTEEKYGQSIRDAPEYAKPYEKSFYNCMFRDGSGTDLCMHHFTDMVRTIYRSGESTLNDKN*
Ga0075467_1045691313300006803AqueousMLKDKSDNFLACKEPIDGMWRCYTEEKYGLSIRDAPDYSKKYENKFYNCLFREGSGTDLCMNHFTDMVRSIYRSGESTLNDKN*
Ga0075467_1049980113300006803AqueousVCHTQMLKDKADNFLACKEPIDGMWRCYTEEKYGQSIRDAPDYSKVYEKKFYSCLFREGSGMDLCMPHFSDMVRSIYRSGESTLNDKY*
Ga0075467_1058917123300006803AqueousMLKDKSDNFLACKEPLDYMWRCYTEEKYGQSIRDAPEYTKPYEKKFYNCLFREGSGTDMCMNHFTDMVRSIYRSGESTLNDKH*
Ga0075464_1016347513300006805AqueousMLLQNADNFLACKEPIDLMWRCYTEEKYGNSIRDAPEYTKQYESRFYDCLFREASGLDVCMQHFSGMVRKIHRSGESTLNTNF*
Ga0075469_1022139723300007231AqueousMLKDKADNFLACKEPIDGMWRCYTEEKYGQSIRDAPDYSKVYEKKFYSCLFREGSGMDLCMPHFSDMVRSIYR
Ga0105019_119088823300007513MarineMLKVKADNFLACKEPIDGMWRCYTEEKYGNSIRDAPDYTKKYEEKFYDCMFRDATGMDYCKPHFNSMIRSIYRSGESTLNDRY*
Ga0102881_118639723300007551EstuarineMLKEKSDNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKLYQCLWREGSGLDLCMNHFSDMVRSIHRSGESTLNDKN*
Ga0102818_106640423300007552EstuarineMLKDKSDNFLACKEPIDGMWRCYTEEKYGNSIRNAPEYAKPYEKKFYNCLFREGSGTDLCMNHFSDMVRSIYRSGESTLNDKF*
Ga0102920_126331013300007600EstuarineMNKDKADNFLACKEPIDGMWSCYTEGKYGNSIRDAPAVAKPYEKKFYNCLFREATGMDVCMSHFSDMVRAIYRSPENELCDWN*
Ga0102866_118086623300007661EstuarineMLKEKADNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTQPYQAKLHNCLWREGSGLDLCMNHFSDMVRAIHR
Ga0102951_117774613300007725WaterVCHTQQLKKGSDNFLACKEPIDAMWRCYTEEKYGQSIRDAPEYTKKYEREFYDCLFRDASGLDVCMNNFSNMVRAIHRSGESELNTNF*
Ga0102893_116757623300008052EstuarineMLKEKSDNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKPYQCLWREGSGLDLCMNHFSDMVRSIHRSGESTLNDKN*
Ga0103732_105763123300008929Ice Edge, Mcmurdo Sound, AntarcticaMYYSIGVDVCHTSMLKENSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGTGMDMCMNHFSDMVRSINRSGESELNANN*
Ga0102963_142791313300009001Pond WaterVCHTQQLKEGSDNFLACKEPIDAMWRCYTEEKYGQSIRDAPEYTKKYEREFYDCLFRHASGLDVCMNNFSNMVRAIHRSGESELNTNF*
Ga0115566_1065503113300009071Pelagic MarineMLKDKADNFLACKKPLDGMWRCYTEEKYGQSIRDAPDYSKKYEAKFYNCLFRDGSGMDLCMPHFSDMVRSIHRSGESTLNDKN*
Ga0115566_1072683523300009071Pelagic MarineMLKDNSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGTGMDLCMNHFSDMVRSIHRSGESELNANN*
Ga0114978_1031177713300009159Freshwater LakeMLVQNADNFLACKEPIDAMWRCYTEEKYGQSIRDAPEYAKKHEAQFYDCMFREATGLDLCMNKFSNMVRAIHRSGESELNTNF*
Ga0114998_1032238723300009422MarineMLKDKSDNFLACKQPIDGLWRCFTEEKYGQSIRDAPEYTKKYEKQFYDCLFRGGSGMDICHGKFTNMVRAIYRSGESELNDKF*
Ga0115562_123212013300009434Pelagic MarineMLKDKADNFLACKQPLDGMWRCYTEEKYGQSIRDAPDYSKKYEAKFYNCLFREGTGMDLCMPHFSDMVRSIHRSGESTLNDKN*
Ga0115008_1027356523300009436MarineMLQQNATNFLACKEPIDAMWRCYTEEKYGPTLRDAPDYTKQYEKRFYNCLFREATGMDVCMNHFSDMIRSIHRSGESTLNTNF*
Ga0115559_127333013300009438Pelagic MarineMLQQNATNFLACKEPIDAMWRCYTEEKYGPTLRDAPDYTKQYEKRFYNCLFRETTGMDVCMNHFSDMIRSIHRSGESTLNTNF*
Ga0115007_1005038813300009441MarineMLLAGATNFLACKQPIDAMWRCYTEEKYGHSLRDAPDYTKQYEKRFYDCMFREASGLDMCMNNFTNMVRAIHRSGESELSTHF*
Ga0115007_1092809713300009441MarineMLKAGSDNFLACKKPIDAMWRCYTEEKYGQSIRDAPEYTKPYEAKFYDCLFRDASGLDVCMSQFGNMVRSIHRSGESELNTQF*
Ga0115569_1030692813300009497Pelagic MarineMLKDNADNFLACKQPIDGMWRCYTEEKYGQSIRDAPDYSKKYEKKFYNCLFREASGMDLCMPHFSNMVRSIYRSGESTLNDKN*
Ga0115099_1021671823300009543MarineMYYSIGVDVCHTSMLKDNSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGSGMDLCMNHFSDMVRSIHRSGESELNANN*
Ga0115103_130236823300009599MarineMLKDGSDNFLACKKPIDMMWRCYTEEKYGQSIRDAPDYTQKYEKKFYNCLFREASGLDLCMNHFTDMIRTIHRSGESTLNTKN*
Ga0115103_182216913300009599MarineMLQQNSTNFLACKEPIDGMWRCYTEEKYGQSIRDAPEYTKQYEKKFYDCLFRQASGLDLCMSNFTNMVRSIHRSGESTLNTQF*
Ga0115102_1064959613300009606MarineMLQAGSDNFLACKEPIDGMWRCYTEEKYGQSIRNAPAYTKPYEKKFYDCLFREASGLDLCMNNFTNMIRSIHRSGESTLNTQF*FP*
Ga0118731_11147746523300010392MarineMMQQKSDNFLACKEPIDGMWRCFTEGKLGNSIRDAPDYVKPYEKKYYDCLFREGGGNDICQQHFHDMVRSVYRAGDGDLC
Ga0118733_10749107213300010430Marine SedimentMMQQKSDNFLACKEPIDGMWRCFTEGKLGNSIRDAPDYVKPYEKKYYDCLFREGGGNDICQQHFHDMVRSVYRAGDGDLCDFY*
Ga0129349_125528213300012518AqueousMLMQNADNFLACKEPIDMMWRCYTEEKYGPSIRNAPEYTKKHEKAFYDCLFREASGLDLCMKHFSGMIREIHRSGESTLNTDF*
Ga0163111_1079162343300012954Surface SeawaterMLKEGSDNFLACKVPIDGMWRCYTEEKYGQSIRDAPDYTKKNEEKFYDCMFREASGLDMCMNHFSDMIRQIHRSG
Ga0164295_1065545013300013014FreshwaterMLKDKSQNFLACKAPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKLYDCLFREGSGMDICQPHFSNMIRAVYRGGDNKLNDKY*
Ga0157374_1132745713300013296Miscanthus RhizosphereMLAGVDVCHSMMLKEKSDNFLACKEPLDGMWRCYTEGKYGQSIRDAPAYTKKYEKKLYDCLFRDATGMDICIPHFNNMIRSIYRSGESELVDWY*
Ga0163162_1064656013300013306Switchgrass RhizosphereMLAGVDVCHSMMLKEKSDNFLACKEPLDGMWRCYTEGKYGQSIRDAPDYTKKYEKKLYDCLFRDATGMDICIPHFNNMIRSIYRSGESELVDWY*
Ga0169931_1068839313300017788FreshwaterMTKEKADNFLACKEPLDQMWNCYTEGKYGNSIRDAPAVSKPYEKNLYNCLFREGTGMDVCMNHFSDMVRAVYRSPENELCDWY
Ga0181571_1064761913300017957Salt MarshMLKEKSDNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKLYQCLWREGSGLDLCMNHFSDMVRAIHRSGESTLNDKN
Ga0181563_1053876523300018420Salt MarshVCHTQMLKDKSDNFLACKEPIDGMWRCYTEEKYGLSIRDAPDYSKKYENKFYNCLFREGSGTDLCMNHFTDMVRSIYRSGESTLNDKN
Ga0181563_1072197623300018420Salt MarshMLKEKSDNFLACKEPLDGMWRCYTEEKYGQTIRDAPDYAKKYEAKLHNCLWREGSGLDLCMNHFSDMVRSIHRSGESTLN
Ga0181563_1072236123300018420Salt MarshMLMQNSDNFLACKEPIDGMWRCYTDERYGMSIRDAPAYTKPHEKAFYNCLFREASGLDMCMNHFTDMLRRIHRSGESELETRF
Ga0192873_1041901013300018974MarineMLREGSDNFLACKVPIDGMWRCYTEEKYGQSIRDAPDYTKKNEEKFYDCMFREASGLDMCMNHFSDMVRQIHRSGESTLNTNFXREVILRLFKLV
Ga0192873_1043365423300018974MarineMLKEGSDNFLACKVPIDGMWRGYTEEKYGQSIRDAPDYTKQNEERFYDCMFREASGLDMCMNHFSDMIRQIHRSGESTLNTNF
Ga0192961_1021730323300018980MarineMYYSIGVDVCHTSMLKDNSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGTGMDLCMNHFSDMVRSIHRSGESELNANN
Ga0192875_1017835713300019035MarineMLKEGSDNFLACKVPIDGMWRCYTEEKYGQSIRDAPDYTKKNEEKFYDCMFREASGLDMCMNHFSDMVRQIHRSGESTLNTNF
Ga0192945_1022032723300019036MarineMLQQKSDNFLACKEPIDGMWRCYTEEKYGQSIRDAPDYTKKYESQFYDCLFREGSGMDLCHGHFNNMIRSIYRSGESELNDRN
Ga0192981_1031190213300019048MarineMMQNADNFLACKKPIDMMWRCYTEEKYGSSIRDAPEISKKHEKSFYDCMFREASGLDMCMRHFTGMIREIHRSGESTLETNFXKTTII
Ga0192981_1033353913300019048MarineMLQKGADNFLACKEPIDAMWRCYTEEKYGQSIRNAPDYTKPYEKKFYDCMFREASGLDLCMNNFSDMVRSIHRSGESTLNTQFXGLITYLTEYI
Ga0192966_1022771223300019050MarineMLQQKSDNFLSCKEPIDGMWRCYTEEKYGQSIRDAPDYTKKYESQFYDCLFREGSGMDLCHGHFNNMIRSIYRSGESELNDRN
Ga0192972_108280213300019108MarineMLQQNASNFLACKEPIDAMWRCYTEEKYGPTLRDAPDYTKQYEKRFYNCLFREATGMDVCMNHFSDMVRAIHRSGESTFNTNF
Ga0194113_1092815813300020074Freshwater LakeMLVQNADNFLACKEPIDAMWRCYTEEKYGQSIRDAPEYTKKHEAQFYDCMFRDATGLDMCMNKFSNMIRAIHRSGESELNTNF
Ga0196977_109889713300020146SoilMLKDKADNFLACKEPIDGMWRCYTENKYGNSIRDAPAFAKPYERNFYDCLFREGSGLDLCMTHFDDMIRSIYRSGESELCDWY
Ga0196977_110523813300020146SoilMLKDKADNFLACKEPIDGMWRCYTENKYGNSIRDAPAYAKPYERNFYDCLFREGSGLDLCMTHFDDMIRSIYRSGENELCDWY
Ga0194115_1041560623300020183Freshwater LakeMLVQNADNFLACKEPIDAMWRCYTEEKYGQSIRDAPEYTKKHEAQFYDCMFRDASGLDMCMNKFSNMIRAIHRSGESELNTNF
Ga0196978_106968713300021067SoilMLKDKADNFLACKEPIDGMWRCYTENKYGNSIRDAPAYAKPYERNFYDCLFREGSGLDLCMTHFDDMIRSIYRSGESELCDWY
Ga0214192_116282513300021142FreshwaterMNKDKADNFLACKEPIDGMWSCYTEGKYGSSIRDAPAFAKPYEKKFYNCLFREATGMDVCMSHFSDMVRAIYRSPENELCDWN
Ga0210307_117763523300021336EstuarineMLKEKSDNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKLYQCLWREGSGLDLCMNHFSDMVRSIHRSGESTLNDKN
Ga0206693_183500723300021353SeawaterMLQAGSDNFLACKEPIDGMWRCYTEEKYGQSIRNAPAYTKPYEKKFYDCLFREASGLDLCMNNFTNMIRSIHRSGESTLNTQFXFP
Ga0206123_1031276513300021365SeawaterMLKDKADNFLACKKPLDGMWRCYTEEKYGQSIRDAPDYSKKYEAKFYNCLFRDGSGMDLCMPHFSDMVRSIHRSGESTLNDKN
Ga0063105_100537323300021887MarineMLQQNATNFLACKEPIDAMWRCYTEEKYGPTLRDAPDYTKQYEKRFYNCLFREATGMDVCMNHFSDMIRSIHRSGESTLNTNF
Ga0255772_1060828413300023176Salt MarshVDVCHTSMLMQNADNFLACKEPIDMMWRCYTEEKYGPSIRNAPEYTKKHEKAFYDCLFREASGLDLCMKHFSGMIREIHRSGESTLNTDF
Ga0244777_1047652023300024343EstuarineMIKDGSDNFLACKKPIDAMWRCYTEEKYGLSIRDAPEYTKKYESNFYNCLFRDASGLDICMGHFSNMVRAIHRSGESELTTHF
Ga0244775_1144093323300024346EstuarineVCHTTMLKEKSDNFLACKEPLDGMWRCYTEEKYGQSIRDAPDYTKKYEKKLYQCLWREGSGLDLCMNHFSDMVRSIHRSGESTLNDKN
Ga0208739_105082813300025426FreshwaterMLKDNASNFLACKAPLDGMWRCYTEEKYGQSIRDAPDYAKKYEKNLYDCLFREGSGMDICQPHFSNMIRAVYRSGDNKL
Ga0208105_104492123300025487FreshwaterMLKDNASNFLACKAPLDGMWRCYTEEKYGQSIRDAPDYAKKYEKNLYDCLFREGSGMDICQPHFSNMIRAVYRSGDNKLNDKYXLLYL
Ga0208783_1028678223300025872AqueousVCHAQMIEQNSNNFLACKQPIDGMWRCFTEEKYGQSIRDAPEYAKPYEKSFYNCMFRDGSGTDLCMHHFTDMVRTIYRSGESTLNDKN
Ga0208544_1005171013300025887AqueousMLKTGSDNFLACKRPIDAMWRCYTEDKYGQSIRDAPEYSKPYEAKFYDCLFRDASGMDMCMGQFGNMVRAIHRSGESELNTNFXKDETHPPIKQHIEIVQTNFSI
Ga0208544_1028469423300025887AqueousVCHTQMLKDKADNFLACKEPIDGMWRCYTEEKYGQSIRDAPDYSKVYEKKFYSCLFREGSGMDLCMPHFSDMVRSIYRSGESTLNDKY
Ga0208544_1033711223300025887AqueousMLKDKSDNFLACKEPLDYMWRCYTEEKYGQSIRDAPEYTKPYEKKFYNCLFREGSGTDMCMNHFTDMVRSIYRSGESTLNDKH
Ga0209631_1033993523300025890Pelagic MarineMLQQKSDNFLACKKPLDGMWKCYTEEKYGTSIRDAPDYAKPYEAKLYDCLFREGSGMDICQNHFTDMVRSIYRSGECELNDKYXKSQKQNIPPCF
Ga0209631_1036194023300025890Pelagic MarineMIIGNLIIFYAGVDVCHTQMLKDKADNFLACKKPLDGMWRCYTEEKYGQSIRDAPDYSKKYEAKFYNCLFRDGSGMDLCMPHFSDMVRSIHRSGESTLNDKN
Ga0208916_1041530313300025896AqueousMLLQNADNFLACKEPIDLMWRCYTEEKYGNSIRDAPEYTKQYESRFYDCLFREASGLDVCMQHFSGMVRKIHRSGESTLNTNF
Ga0209425_1035134323300025897Pelagic MarineMLKDNSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGTGMDLCMNHFSDMVRSIHRSGESELNANN
Ga0208020_105736623300027159EstuarineMQMLKDKSDNFLACKEPIDGMWRCYTEEKYGNSIRNAPEYAKPYEKKFYNCLFREGSGTDLCMNHFSDMVRSIYRSGESTLNDKF
Ga0209302_1022002313300027810MarineMLQQNATNFLACKEPIDAMWRCYTEEKYGPTLRDAPDYTKQYEKRFYNCLFREATGMDVCMNHFSDMIRSIHRSGESTLNTNFXQLRETIARYIYLTQTLFFSGLWGFGVLG
Ga0209302_1042217713300027810MarineMLLAGATNFLACKQPIDAMWRCYTEEKYGHSLRDAPDYTKQYEKRFYDCMFREASGLDMCMNNFTNMVRAIHRSGESELSTHF
Ga0209092_1003875813300027833MarineMLQQNATNFLACKEPIDAMWRCYTEEKYGPTLRDAPDYTKQYEKRFYNCLFREATGMDVCMNHFSDMIRSIHRSGESTLNTNFXQLRETIARYIYLTQTLFFSGLWGFGVLGF
Ga0247566_108122713300028335SeawaterMLKDKADNFLACKEPIDGMYRCYTEEKFGHSIRDAPDYAKKYERNFYGCLFREGTGMDLCMNHFTDIVRSIYRNEPGELNDKH
Ga0311342_1111287623300029955BogMTKDKADNFLACKEPLDGMWSCYTEGKYGASIRDAPADAKPYEKKLYDCLFREATGLDVCISHFSDMVRTVYRTPENELIDWY
Ga0210256_1028959713300030564SoilMLKDKADNFLACKEPIDSMWRCYTEDKYGKSIRDAPDYTKQYEAKFYECLFREASGTDLCMNHFTDMVRSIYRSPENELCDWF
Ga0210251_1000695123300030624SoilMMKDKADNFLACKEPIDSMWRCYTEDKYGKSIRDAPDYTKQYEKKFYECLFREASGTDLCMNHFTDMVRSIYRSPENELCDWF
Ga0210259_1017666823300030625SoilMKDKADNFLACKEPIDSMWRCYTEDKYGKSIRDAPDYTKQYEKKFYECLFREASGTDLCMNHFTDMVRSIYRSPENELCDWF
Ga0210250_1129700013300030632SoilVCLTQMMKDKADNFLACKEPIDSMWRCYTEDKYGKSIRDAPDYTKQYEKKFYECLFREASGTDLCMNHFTDMVRSIYRSPENELCDWF
Ga0265462_1220959613300030738SoilMMKQRADNFLACKQPIDMMWRCYTENKYGHSIRDAPEYAKPYEKKFYECFFREASGLDLCMNHFSDMVRSIYRSPENELCDWY
Ga0265459_1369686323300030741SoilMMKANADNFLACKEPIDGMWSCYTEGKYGDSIREAPANTKQYEKKFYDCLFREASGLDICMGHFTDMVRTVYRSPENELCDWY
Ga0265459_1393850023300030741SoilMMKANSDNFLACKEPIDGMWSCYTEGKYGDSIRDAPAYTKQYEKKFYDCLFREASGLDMCMNHFTDMVRSVYRSPDNELCDWY
Ga0265459_1425803513300030741SoilMLKDKADNFLACKDPIDGMWRCYTEGKYGLSIRDAPKETKDFEKKFYQCLFREAAGMDVCMNHFSDMIRTIYRSPENELCDWY
Ga0075398_1041663013300030778SoilMLTQKADNFLACKEPIDGMWRCFTEGKYGHSIRDAPQISKEYEQKFYKCLFREASGTDMCMNHFTDMVRAIYRSPDNQLCDWN
Ga0073963_1091592523300030859MarineVRLLGNKHRQCRYYSIGVDVCHTAMLQQGADNFLACKEPIDSMWRCYTDEKYGLSIRDAPEYAKKHEAKFYDCLFREATGMDLCMKHFGNMVRSIHRSGESELETNF
Ga0068589_1031708823300030979SoilVCHTSMLTQKADNFLACKEPIDGMWRCFTEGKYGHSIRDAPQISKEYEQKFYKCLFREASGTDMCMNHFTDMVRAIYRSPDNQLCDWNXRNKLSLYSDLFKLL
Ga0307974_107023813300031211Saline WaterMKHNSDNFLACKKPIDAMWSCYTEGKYGMSIRDAPAYSKEFEAKFYNCLFREGNQTEHCMNHFTDMVRSVYRSGDGLLCDWYXLFK
Ga0307948_105805233300031221Saline WaterMKHNSDNFLACKKPIDAMWSCYTEGKYGMSIRDAPAYSKEFEAKFYNCLFREGNQTEHCMNHFTDMVRSVYRSGDGLLCDWYXLF
Ga0170824_10399248913300031231Forest SoilLGNRLRQCNYYQIGVEICHTAMMKANADNFLACKEPIDGMWSCFTEGKYGDSIRDAPDYTKQYEKKFYDCLFREASGLDICMSHFTDMVRSVYRSPENELCDWY
Ga0170824_10680625923300031231Forest SoilMLKDKADNFLACKEPIDSMWRCYTEDKYGKSIRDAPDYTKQYEAKFYECLFREASGTDLCMNHFTDMVRSIYRSPENELCDWFXVIKLDD
Ga0170824_12344882023300031231Forest SoilMMKQKSDNFLACKAPIDGMWRCYTENKYGQSIRDAPDHTKEYEKRFYQCLFREGSGLDLCMNHFTDMVRSVYRSPENELNDWY
Ga0307489_1093641713300031569Sackhole BrineMLKEKADNFLACKEPLDGMWRCYTEEKYGQGIREAPEYTKKYETKLHNCLWREGTGLDLCMNHFSNMVRAIHRSGESTLNDKH
Ga0302125_1016823523300031638MarineMLKAGSDNFLACKKPIDAMWRCYTEEKYGQSIRDAPEYTKPYEAKFYDCLFRDASGLDVCMSQFGNMVRSIHRSGESELNTQFXEGYCCKHKGGAISI
Ga0307946_109638333300031684Saline WaterMMKHNSDNFLACKKPIDAMWSCYTEGKYGMSIRDAPAYSKEFEAKFYNCLFREGNQTEHCMNHFTDMVRSVYRSGDGLLCDWY
Ga0307391_1092207323300031729MarineMLKAGSDNFLACKKPIDGMWRCYTEEKYGLSIRDAPAYTKPYETKFYDCLFRDASGLDMCMSHFGNMVRSIHRSGESELNTNF
Ga0307404_1050336723300031752MarineMYYSIGVDVCHTSMLKENSDNFLACKEPIDGMWRCYTEEKYGHSIRDAPDYTKKYEKKFYNCLFREGTGMDMCMNHFSDMVRSINRSGESELNANN
Ga0315907_1112259623300031758FreshwaterMNKDKADNFLACKEPIDGMWSCYTEGKYGNSIRDAPAVAKPYEKKFYNCLFREATGMDVCMSHFSDMVRAIYRSPENELCDWN
Ga0315270_1074759623300032275SedimentMLQAGSDNFLACKKPIDAMWRCYTEDKYGASIRDAPEYTKPYEAKFYDCLFRDASGLDICMKNFGNMIRSIHRSGESELNSNF
Ga0314688_1009941033300032517SeawaterMLKDKADNFLACKQPLDGMWRCYTEEKYGQSIRDAPDYSKKYEAKFYNCLFREGTGMDLCMPHFSNMVRSIHRSGEST


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.