NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087006

Metagenome / Metatranscriptome Family F087006

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087006
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 41 residues
Representative Sequence MIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRND
Number of Associated Samples 99
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.82 %
% of genes near scaffold ends (potentially truncated) 99.09 %
% of genes from short scaffolds (< 2000 bps) 92.73 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(12.727 % of family members)
Environment Ontology (ENVO) Unclassified
(20.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.04%    β-sheet: 0.00%    Coil/Unstructured: 86.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13561adh_short_C2 29.09
PF00106adh_short 6.36
PF00296Bac_luciferase 6.36
PF03328HpcH_HpaI 3.64
PF02417Chromate_transp 3.64
PF00885DMRL_synthase 2.73
PF12681Glyoxalase_2 2.73
PF13378MR_MLE_C 1.82
PF02515CoA_transf_3 1.82
PF01370Epimerase 1.82
PF04909Amidohydro_2 1.82
PF01183Glyco_hydro_25 1.82
PF00903Glyoxalase 1.82
PF10397ADSL_C 0.91
PF07883Cupin_2 0.91
PF02518HATPase_c 0.91
PF12773DZR 0.91
PF12770CHAT 0.91
PF03473MOSC 0.91
PF08502LeuA_dimer 0.91
PF13466STAS_2 0.91
PF01402RHH_1 0.91
PF01042Ribonuc_L-PSP 0.91
PF01569PAP2 0.91
PF05016ParE_toxin 0.91
PF01063Aminotran_4 0.91
PF02627CMD 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 6.36
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 3.64
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 3.64
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 3.64
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 3.64
COG00546,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)Coenzyme transport and metabolism [H] 2.73
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.82
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 1.82
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 1.82
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.91
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.91
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.91
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10107400All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300000956|JGI10216J12902_100046122All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300002560|JGI25383J37093_10195198All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300002908|JGI25382J43887_10014883All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4057Open in IMG/M
3300004157|Ga0062590_100309281All Organisms → cellular organisms → Bacteria → Proteobacteria1236Open in IMG/M
3300004463|Ga0063356_102658090All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005166|Ga0066674_10257095All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium827Open in IMG/M
3300005181|Ga0066678_10021735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3372Open in IMG/M
3300005332|Ga0066388_102620713All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium919Open in IMG/M
3300005353|Ga0070669_100876744All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005445|Ga0070708_102252554All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005471|Ga0070698_100822075All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300005576|Ga0066708_11063752Not Available502Open in IMG/M
3300005577|Ga0068857_102158917All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300005713|Ga0066905_100751131All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005719|Ga0068861_101847120All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005764|Ga0066903_104202316All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium770Open in IMG/M
3300005843|Ga0068860_100080975All Organisms → cellular organisms → Bacteria → Proteobacteria3088Open in IMG/M
3300006755|Ga0079222_10292688All Organisms → cellular organisms → Bacteria1057Open in IMG/M
3300006844|Ga0075428_100522387All Organisms → cellular organisms → Bacteria → Proteobacteria1270Open in IMG/M
3300006845|Ga0075421_100986826All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300006846|Ga0075430_101775360All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300006852|Ga0075433_11797848All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006853|Ga0075420_101161373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria664Open in IMG/M
3300006871|Ga0075434_100424532All Organisms → cellular organisms → Bacteria1351Open in IMG/M
3300006876|Ga0079217_11548721All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300009089|Ga0099828_11279991All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009094|Ga0111539_10699013Not Available1180Open in IMG/M
3300009100|Ga0075418_12052665All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300009137|Ga0066709_100001020All Organisms → cellular organisms → Bacteria → Proteobacteria17388Open in IMG/M
3300009137|Ga0066709_100429390All Organisms → cellular organisms → Bacteria → Proteobacteria1841Open in IMG/M
3300009820|Ga0105085_1023872All Organisms → cellular organisms → Bacteria → Proteobacteria1064Open in IMG/M
3300010043|Ga0126380_10201709All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1333Open in IMG/M
3300010043|Ga0126380_12030178All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010047|Ga0126382_10477220All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300010047|Ga0126382_10488460All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium986Open in IMG/M
3300010047|Ga0126382_11285579All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria660Open in IMG/M
3300010326|Ga0134065_10149151All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300010329|Ga0134111_10510921All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300010358|Ga0126370_10274111All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1323Open in IMG/M
3300010359|Ga0126376_12067662Not Available612Open in IMG/M
3300010360|Ga0126372_12748995All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium544Open in IMG/M
3300010362|Ga0126377_10206718All Organisms → cellular organisms → Bacteria1886Open in IMG/M
3300010366|Ga0126379_13576119All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium521Open in IMG/M
3300010398|Ga0126383_13280626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium529Open in IMG/M
3300010398|Ga0126383_13593436All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium506Open in IMG/M
3300012202|Ga0137363_11441422All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012207|Ga0137381_11225661All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300012349|Ga0137387_10999939All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012355|Ga0137369_10242208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1368Open in IMG/M
3300012357|Ga0137384_10049955All Organisms → cellular organisms → Bacteria3460Open in IMG/M
3300012358|Ga0137368_10612994All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium690Open in IMG/M
3300012358|Ga0137368_10912840All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300012918|Ga0137396_11102082All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium567Open in IMG/M
3300012930|Ga0137407_10700145All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300012948|Ga0126375_10267260Not Available1168Open in IMG/M
3300015264|Ga0137403_10232227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1763Open in IMG/M
3300015371|Ga0132258_10641890All Organisms → cellular organisms → Bacteria → Proteobacteria2669Open in IMG/M
3300015372|Ga0132256_101242204Not Available858Open in IMG/M
3300015374|Ga0132255_101331597All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300018074|Ga0184640_10377249All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300018079|Ga0184627_10245892All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300018079|Ga0184627_10672751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300018433|Ga0066667_11933224All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300019360|Ga0187894_10209673Not Available946Open in IMG/M
3300019361|Ga0173482_10358882All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300020074|Ga0194113_10170932All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300021073|Ga0210378_10370910All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300021080|Ga0210382_10259889All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300021560|Ga0126371_12517948Not Available623Open in IMG/M
(restricted) 3300023208|Ga0233424_10003609All Organisms → cellular organisms → Bacteria9853Open in IMG/M
3300025912|Ga0207707_11035008All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300025912|Ga0207707_11501733All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300025921|Ga0207652_10688880All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300025923|Ga0207681_10504107All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300025942|Ga0207689_11704685All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300026285|Ga0209438_1129318All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300026342|Ga0209057_1154034All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300026497|Ga0257164_1092499All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300026537|Ga0209157_1369786All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300026538|Ga0209056_10011876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8784Open in IMG/M
3300027379|Ga0209842_1079878All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300027511|Ga0209843_1064911All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300027748|Ga0209689_1359655All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300027787|Ga0209074_10236691Not Available703Open in IMG/M
3300027909|Ga0209382_11086227All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium827Open in IMG/M
3300027909|Ga0209382_12153703All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium529Open in IMG/M
3300028380|Ga0268265_11212400All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium752Open in IMG/M
3300028381|Ga0268264_10837701All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium921Open in IMG/M
3300028828|Ga0307312_11133383All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300028889|Ga0247827_10673646All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300030006|Ga0299907_10992013All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium618Open in IMG/M
3300030620|Ga0302046_10887079All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium714Open in IMG/M
3300030903|Ga0308206_1056585All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031092|Ga0308204_10237799All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031152|Ga0307501_10181996All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300031782|Ga0318552_10344642All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300031805|Ga0318497_10106172All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300031949|Ga0214473_10736848Not Available1070Open in IMG/M
3300032000|Ga0310903_10076326All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300032012|Ga0310902_11142972All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300032180|Ga0307471_100980115Not Available1012Open in IMG/M
3300032180|Ga0307471_101688603All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300032180|Ga0307471_101959183All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium734Open in IMG/M
3300032205|Ga0307472_102358017All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300033289|Ga0310914_10971660All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300033550|Ga0247829_11175615All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300034176|Ga0364931_0086893Not Available979Open in IMG/M
3300034177|Ga0364932_0156828All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina866Open in IMG/M
3300034661|Ga0314782_105285All Organisms → cellular organisms → Bacteria644Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil12.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.73%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.73%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.73%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.73%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.91%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.91%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1010740013300000597Forest SoilMIVDIHAHYFPKEYLDLLVSIGGRSLPEAARPLTARPG
JGI10216J12902_10004612223300000956SoilMIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQDDPAGIL
JGI25383J37093_1019519823300002560Grasslands SoilMIVDIHAHYFPKEYNDTLLRIGGRSVPEAARPTTARPMRNDD
JGI25382J43887_1001488363300002908Grasslands SoilMIVDIHAHYFPKAYNDALLRIGGRSLPEAARSLTARTIRN
Ga0062590_10030928133300004157SoilMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRHDDP
Ga0063356_10265809023300004463Arabidopsis Thaliana RhizosphereMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRHDDPSGLP
Ga0066674_1025709513300005166SoilMIVDIHAHYLPKVYNDILLRIGGRSLPEAARPSTARPMRNDD
Ga0066678_1002173553300005181SoilMIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDLA
Ga0066388_10262071333300005332Tropical Forest SoilMIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQ
Ga0070669_10087674433300005353Switchgrass RhizosphereMIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPSTARPMRND
Ga0070708_10225255413300005445Corn, Switchgrass And Miscanthus RhizosphereMIVDVHAHYFPKEYTDILMRIGGRSLPEAARPRTARPMRQDAPAGI
Ga0070698_10082207513300005471Corn, Switchgrass And Miscanthus RhizosphereMIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDLAGI
Ga0066708_1106375223300005576SoilVIVDIHAHYFPRAYNDLLVRIGGRSLPEAARALTARPMRHDDAAEIAT
Ga0068857_10215891713300005577Corn RhizosphereMIVDIHAHYFPKTYIDTLLRIGGRSLPEAARAITKRTIRND
Ga0066905_10075113113300005713Tropical Forest SoilMIVDIHAHYFPQEYTDLLMRIGGRTLPEAARPLTARPMRQDAPA
Ga0068861_10184712023300005719Switchgrass RhizosphereMIVDIHAHYFAKEYIDLLMSIGGRSVPEAARALTAGQ
Ga0066903_10420231623300005764Tropical Forest SoilMIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTAR
Ga0068860_10008097513300005843Switchgrass RhizosphereMIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPSTARPMRNDDPS
Ga0079222_1029268823300006755Agricultural SoilMIVDVHAHYFPKAYMDLLVRIGGRSLPEAARAITARPLRYD
Ga0075428_10052238713300006844Populus RhizosphereMIVDIHAHYFPKDYNDLLLRIGGRSLPEAARASTARPMRNDDLSGIP
Ga0075421_10098682623300006845Populus RhizosphereMIVDIHAHYFPKTYIDTLLRIGGRSLPEAARAITKRTIRNDDPSQI
Ga0075430_10177536013300006846Populus RhizosphereMIVDIHAHYFPKTYIDTLLRIGGRSLPEAARAITKRTIRNDDPSQIPTR
Ga0075433_1179784813300006852Populus RhizosphereMIADIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDLTGI
Ga0075420_10116137313300006853Populus RhizosphereMIVDVHAHYFPREYTDLLMRIGGRTLPEAARPLTARPMR
Ga0075434_10042453233300006871Populus RhizosphereMIVDVHAHYFPQAYTDILMRIGGRSLPEAARPRTARPMRQDNP
Ga0079217_1154872123300006876Agricultural SoilVIVDIHAHYFPKAYNDTLLRIGGRSLPESARALTARPPRND
Ga0099828_1127999113300009089Vadose Zone SoilMIVDIHAHYFPKEYNDLLLRIGGRSVPEAARPITARPMRQDDS
Ga0111539_1069901323300009094Populus RhizosphereMIVDIHAHYFPRAYNDALMGIGGRSLPEAARALTARPPR
Ga0075418_1205266513300009100Populus RhizosphereMIVDVHAHYFPKEYNDLLLRIGGRSLPEAARPATARPMRDD
Ga0066709_100001020213300009137Grasslands SoilMIVDIPAHYFPKEYNDLLLRIGGRSLPDGAPPITPRPTRPGRCLG
Ga0066709_10042939013300009137Grasslands SoilMIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQDDP
Ga0105085_102387233300009820Groundwater SandMIVDIHAHYFPKEYNDILLRIGGRSLPEAARPITARPMREDDSAK
Ga0126380_1020170933300010043Tropical Forest SoilVIVDIHAHYFPKAYNATLLRIGGRSLPESARALTA
Ga0126380_1203017823300010043Tropical Forest SoilMIVDIHAHYFPQSYLNLLVRIGGRSLPEAARPLTARP
Ga0126382_1047722013300010047Tropical Forest SoilMIVDIHAHYFAKEYIDLLMSIGGRSVPVAARALTAG
Ga0126382_1048846023300010047Tropical Forest SoilMIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARP
Ga0126382_1128557913300010047Tropical Forest SoilMIVDVHAHYFPKPYIETLMRIGGRSLPEAARALTPRPLMQ
Ga0134065_1014915113300010326Grasslands SoilMIVDIHAHYFPNPYNDALLRIGGRSLPEAARSLTARTIRNDDPS
Ga0134111_1051092113300010329Grasslands SoilMIVDVHAHYFPKAYNELLVRIGGKSLPEAARPLTARPMREDDAS
Ga0126370_1027411123300010358Tropical Forest SoilVIVDIHAHYFPKAYNDTLQRIGGRSLPESARALTARPPRNDEPS
Ga0126376_1206766223300010359Tropical Forest SoilMIVDVHAHYFPKEYTDLLMRIGGHSLPEAARPRTARPMRQD
Ga0126372_1274899513300010360Tropical Forest SoilVIVDIHAHYFPKAYNDTLLRIGGRSLPESARALTARP
Ga0126377_1020671813300010362Tropical Forest SoilMIVDIHAHYFPQEYTDLLLRIGGRTLPEAARPLTARPMR
Ga0126379_1357611923300010366Tropical Forest SoilMIVDIHAHYFPKEYIDLLVSIGGRSLPEAARLLTA*
Ga0126383_1328062623300010398Tropical Forest SoilMARVIVDVHAHYFPKSYIETLMRIGGRSLPEAARALTPRPLMQDDPAGLEKRF
Ga0126383_1359343623300010398Tropical Forest SoilMIVDIHAHYFPKAYNDTLVRIGGRSLPEVARAMTARPMRHDDLTG
Ga0137363_1144142223300012202Vadose Zone SoilMIVDLHAHYFPKDYNAILLRIGGRSLPEAARPITARPMREDDP
Ga0137381_1122566123300012207Vadose Zone SoilMIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPSTARPMRNDDLAGIQ
Ga0137387_1099993923300012349Vadose Zone SoilMIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRNDDAAGIP
Ga0137369_1024220813300012355Vadose Zone SoilMIVDIHAHYFPKEYNDLLLRIGGRSVPEAARPITARPMRQ
Ga0137384_1004995553300012357Vadose Zone SoilMIVDLHAHYFPKDYNAILLRIGGRSLPEAARPITARPMREDD
Ga0137368_1061299413300012358Vadose Zone SoilMIADVHAHYFPKAYTDLLLRIGGRSLPEAARPRTARPMRQDDPA
Ga0137368_1091284013300012358Vadose Zone SoilMIIDVHAHFFPKAYTDLLLRIGGRSLPEAARPRTA
Ga0137396_1110208223300012918Vadose Zone SoilMIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTARPMRND
Ga0137407_1070014523300012930Vadose Zone SoilMIVDVHAHYFPQEYTDILMRIGGRSLPEAARPRTARPLRQDD
Ga0126375_1026726013300012948Tropical Forest SoilVIVDIHAHYFPKAYNDTLLRIGGRSLPESARALTA
Ga0137403_1023222733300015264Vadose Zone SoilMIVDVHAHYFPQEYNDILMRIGGRSLPEAARPRTAR
Ga0132258_1064189053300015371Arabidopsis RhizosphereMIVDIHAHYFPKAYNDKLLSIGGRSLPEAARALTARPMR
Ga0132256_10124220423300015372Arabidopsis RhizosphereMIVDIHAHYFPQGYTDLLMRIGGRTLPEAARPLTARPMRQD
Ga0132255_10133159713300015374Arabidopsis RhizosphereMIVDVHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQE
Ga0184640_1037724913300018074Groundwater SedimentMIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPTTARPMRNDD
Ga0184627_1024589213300018079Groundwater SedimentMIVDIHAHYFPQAYNDLLLRIGGRSLPEAARPRTARPMRT
Ga0184627_1067275123300018079Groundwater SedimentMIIDVHAHYFPKAYNDLLLRIGGRSLPEAARPITAR
Ga0066667_1193322413300018433Grasslands SoilMIVDVHAHYFPQAYTDILMRIGGRSLPEAARPRTARPMRQDAP
Ga0187894_1020967313300019360Microbial Mat On RocksVIVDIHAHYFPKAYMDTLVSIGGLSRPEATRPRTARPLRHDDP
Ga0173482_1035888213300019361SoilMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITA
Ga0194113_1017093233300020074Freshwater LakeMPAMITDIHAHYFPQAYNETLLRIGGRSLPEAARAITARAIRHDDPSQIP
Ga0210378_1037091013300021073Groundwater SedimentMIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPTTARPMRNDDASGIA
Ga0210382_1025988923300021080Groundwater SedimentMIVDIHAHYFPKAYNDTLVRIGGRSLPEAARAITARAPRN
Ga0126371_1251794823300021560Tropical Forest SoilVIVDIHAHYFPKAYNNMLLRIGGRSLPESARALTARPPRNDEPSSI
(restricted) Ga0233424_10003609143300023208FreshwaterMIVDIHAHYFPKAYNDTLLRIGGRSLPEAARAITAIPGRP
Ga0207707_1103500813300025912Corn RhizosphereMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRH
Ga0207707_1150173323300025912Corn RhizosphereMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMR
Ga0207652_1068888023300025921Corn RhizosphereMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARPITARPMRHDDPAGLPE
Ga0207681_1050410723300025923Switchgrass RhizosphereMIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPSTAR
Ga0207689_1170468513300025942Miscanthus RhizosphereMIVDIHAHYFPQAYTDLLMRIGGRSLPDSARPRTARPMRQDDP
Ga0209438_112931823300026285Grasslands SoilMIVDIHAHYFPKAYNDALLRIGGRSLPEAARSLTARTIRND
Ga0209057_115403423300026342SoilMIVDIHAHYFPKPYNDALLRIGGRSLPEAARSLTARTIRND
Ga0257164_109249923300026497SoilMIVDLHAHYFPKDYNAILLRIGGRSLPEAARPITARPMREDDPAGLATR
Ga0209157_136978623300026537SoilMIVDIHAHYFGKEYIDRLMSIGGRSVPEAARALTAG
Ga0209056_1001187613300026538SoilMIVDIHAHYFPKPYNDALLCIGGRSLPEAARSLTART
Ga0209842_107987823300027379Groundwater SandMIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPTTARP
Ga0209843_106491123300027511Groundwater SandMIVDIHAHYFPKEYTDLLVRIGGRSLPESARALTARPIRQDDSSG
Ga0209689_135965513300027748SoilMIVDIHAHYFPKEYNDLLLRIGGRSLPEAARPSTAR
Ga0209074_1023669123300027787Agricultural SoilMIVDIHAHYFPKAYNDLLVRIGGRSLPEAARALTARPMRHDD
Ga0209382_1108622733300027909Populus RhizosphereMIVDIHAHYFPKAYNDKLVSIGGKSLPEAARALTA
Ga0209382_1215370323300027909Populus RhizosphereMIVDIHAHYFPKAYNALLMRIGGKSLPESARALTAR
Ga0268265_1121240013300028380Switchgrass RhizosphereMIVDIHAHYFPKPYNDLLLRIGGRSLPEAARPSTARPMRNDDPSGI
Ga0268264_1083770123300028381Switchgrass RhizosphereMIVDIHAHYFPKEYNALLLRIGGKSLPEAARAITARRMRDDDLSGIP
Ga0307312_1113338323300028828SoilMIVDLHAHYFPKDYNALLLRIGGRSLPEAARPITARPMREDDPA
Ga0247827_1067364623300028889SoilMIVDIHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQ
Ga0299907_1099201313300030006SoilMIVDVHAHYFPQAYTDFLLRIGGRSLPEAARSLTAQSMRR
Ga0302046_1088707923300030620SoilMIVDLHAHHSSREYVETLTRIGGKSLPEAARSLTARPMRMDNPNDLEQRF
Ga0308206_105658513300030903SoilMVVDVHADYFPQEYTDILMCIGGRSLPEAARLLNDRYAGLV
Ga0308204_1023779923300031092SoilMIVDVHAHYFPQEYTDILMRIGGRSLPEAARPRTARPMRQDDP
Ga0307501_1018199613300031152SoilMIVDIHAHYFPKEYNDLLVRIGGRSLPEAARPSTARPMRNDD
Ga0318552_1034464213300031782SoilMIVDIHAHYFPKDYNDLLLRIGGRRLPEAARPITARPMRNHDPASIEK
Ga0318497_1010617223300031805SoilMIVDIHAHYFPKDYNDLLLRIGGRSLPEAARPITARP
Ga0214473_1073684823300031949SoilMIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPITARPMREDDPSG
Ga0310903_1007632633300032000SoilMIVDIHAHYFPKEYNDTLLRIGGRSLPEAARPSTARP
Ga0310902_1114297213300032012SoilMIVDIHAHYFPQAYTDLLMRIGGRSLPEAARPRTARPMRQDDPAG
Ga0307471_10098011523300032180Hardwood Forest SoilMIVDIHAHFFPQAYMDLLMRIGGKSLPEAARPLTGRPGGRP
Ga0307471_10168860313300032180Hardwood Forest SoilMIVDIHAHYFAKEYIDRLMSIGGRSVPEAARALTAGQLRR
Ga0307471_10195918323300032180Hardwood Forest SoilMIVDIHAHYFPKAYNDLLLRIGGRSLPEAARPSTARPMRNDDPSGIP
Ga0307472_10235801723300032205Hardwood Forest SoilMIVDIHAHYFPQAYMDLLMRIGGKSLPEAARPLTARPGGRPHDPN
Ga0310914_1097166023300033289SoilMIVDIHAHYFPKDYNDLLLRIGGRRLPEAARPITARP
Ga0247829_1117561523300033550SoilMIVDVHAHYFPKEYNDLLLRIGGRSLPEAARPATARPMR
Ga0364931_0086893_1_1113300034176SedimentMIVDVHAHYFPKAYNDILMRIGGRSLPEAARPITARP
Ga0364932_0156828_723_8663300034177SedimentMIVDVHAHYFPQGYTDLLICIGGRGLPEAARPITARPMRQDDPAGIPT
Ga0314782_105285_511_6423300034661SoilMIVDIHAHYFPQEYTDLLMRIGGRSLPEAARPRTARPMRQNDPA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.