NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086996

Metagenome Family F086996

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086996
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 50 residues
Representative Sequence MPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVLRRRGR
Number of Associated Samples 87
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.55 %
% of genes near scaffold ends (potentially truncated) 38.18 %
% of genes from short scaffolds (< 2000 bps) 83.64 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(10.000 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(74.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.32%    β-sheet: 0.00%    Coil/Unstructured: 73.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF07722Peptidase_C26 49.09
PF03928HbpS-like 2.73
PF00903Glyoxalase 1.82
PF13685Fe-ADH_2 1.82
PF02774Semialdhyde_dhC 0.91
PF08447PAS_3 0.91
PF00171Aldedh 0.91
PF12697Abhydrolase_6 0.91
PF00753Lactamase_B 0.91
PF13649Methyltransf_25 0.91
PF14329DUF4386 0.91
PF12681Glyoxalase_2 0.91
PF05988DUF899 0.91
PF00877NLPC_P60 0.91
PF06348DUF1059 0.91
PF03486HI0933_like 0.91
PF10823DUF2568 0.91
PF10094DUF2332 0.91
PF07992Pyr_redox_2 0.91
PF01243Putative_PNPOx 0.91
PF00282Pyridoxal_deC 0.91
PF13561adh_short_C2 0.91
PF13191AAA_16 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 1.82
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.82
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.91
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.91
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.91
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 0.91
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 0.91
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 0.91
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.91
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 0.91
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 0.91
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.91
COG0002N-acetyl-gamma-glutamylphosphate reductaseAmino acid transport and metabolism [E] 0.91
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.91
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 0.91
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 0.91
COG0136Aspartate-semialdehyde dehydrogenaseAmino acid transport and metabolism [E] 0.91
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.91
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 0.91
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_10057205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2702Open in IMG/M
3300001686|C688J18823_10114498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1872Open in IMG/M
3300001686|C688J18823_10569507Not Available724Open in IMG/M
3300002568|C688J35102_119709433Not Available754Open in IMG/M
3300002568|C688J35102_119781814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia773Open in IMG/M
3300002568|C688J35102_120322264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter989Open in IMG/M
3300002568|C688J35102_120487103All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300002568|C688J35102_120922310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2373Open in IMG/M
3300002568|C688J35102_120952630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2946Open in IMG/M
3300002568|C688J35102_120962095All Organisms → cellular organisms → Bacteria3272Open in IMG/M
3300004081|Ga0063454_101390306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter594Open in IMG/M
3300004114|Ga0062593_103327567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300004463|Ga0063356_100156684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2608Open in IMG/M
3300004479|Ga0062595_100249882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1149Open in IMG/M
3300004479|Ga0062595_102341293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter528Open in IMG/M
3300004480|Ga0062592_102499835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium519Open in IMG/M
3300005093|Ga0062594_102035941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter615Open in IMG/M
3300005329|Ga0070683_101069989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter775Open in IMG/M
3300005329|Ga0070683_101167734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter740Open in IMG/M
3300005331|Ga0070670_101818191Not Available561Open in IMG/M
3300005334|Ga0068869_101876151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter537Open in IMG/M
3300005336|Ga0070680_100946733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia743Open in IMG/M
3300005337|Ga0070682_100608900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter864Open in IMG/M
3300005337|Ga0070682_101241965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia630Open in IMG/M
3300005338|Ga0068868_100137877All Organisms → cellular organisms → Bacteria2001Open in IMG/M
3300005338|Ga0068868_100255597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1476Open in IMG/M
3300005339|Ga0070660_100651983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales882Open in IMG/M
3300005341|Ga0070691_10791818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter577Open in IMG/M
3300005344|Ga0070661_101194218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia636Open in IMG/M
3300005347|Ga0070668_102252568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter504Open in IMG/M
3300005355|Ga0070671_101644198All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005356|Ga0070674_100936809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales756Open in IMG/M
3300005437|Ga0070710_10711512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales710Open in IMG/M
3300005441|Ga0070700_101392514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter592Open in IMG/M
3300005455|Ga0070663_100261465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1373Open in IMG/M
3300005455|Ga0070663_101829181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter545Open in IMG/M
3300005456|Ga0070678_100766664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales874Open in IMG/M
3300005457|Ga0070662_100593764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter931Open in IMG/M
3300005459|Ga0068867_100102883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2184Open in IMG/M
3300005466|Ga0070685_10528583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia839Open in IMG/M
3300005539|Ga0068853_100872095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales864Open in IMG/M
3300005544|Ga0070686_100390646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1056Open in IMG/M
3300005563|Ga0068855_101464024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter702Open in IMG/M
3300005564|Ga0070664_100135212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2167Open in IMG/M
3300005578|Ga0068854_100612677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter931Open in IMG/M
3300005615|Ga0070702_100416311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales966Open in IMG/M
3300005615|Ga0070702_101736709Not Available520Open in IMG/M
3300005616|Ga0068852_100989088All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005834|Ga0068851_10534543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter707Open in IMG/M
3300005844|Ga0068862_100206887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1772Open in IMG/M
3300006755|Ga0079222_11100511Not Available698Open in IMG/M
3300006844|Ga0075428_101512574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter703Open in IMG/M
3300006854|Ga0075425_101339031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter811Open in IMG/M
3300006871|Ga0075434_100714974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1019Open in IMG/M
3300006931|Ga0097620_101331415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter792Open in IMG/M
3300006954|Ga0079219_11547654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia604Open in IMG/M
3300009094|Ga0111539_10891699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1034Open in IMG/M
3300009094|Ga0111539_11377792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter818Open in IMG/M
3300009148|Ga0105243_11705896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter659Open in IMG/M
3300009156|Ga0111538_11298878All Organisms → cellular organisms → Bacteria → Terrabacteria group919Open in IMG/M
3300009174|Ga0105241_11621507Not Available626Open in IMG/M
3300009176|Ga0105242_12057794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter614Open in IMG/M
3300010399|Ga0134127_10996170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.898Open in IMG/M
3300012212|Ga0150985_101141621Not Available533Open in IMG/M
3300012212|Ga0150985_110718855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter terrae769Open in IMG/M
3300012469|Ga0150984_114014274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300012469|Ga0150984_114855211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter terrae946Open in IMG/M
3300013102|Ga0157371_11109670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia607Open in IMG/M
3300013296|Ga0157374_10098234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2803Open in IMG/M
3300013306|Ga0163162_10803651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis1058Open in IMG/M
3300014326|Ga0157380_10144247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2050Open in IMG/M
3300014969|Ga0157376_11453951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia718Open in IMG/M
3300014969|Ga0157376_11659492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia674Open in IMG/M
3300015371|Ga0132258_10544253All Organisms → cellular organisms → Bacteria2909Open in IMG/M
3300015371|Ga0132258_11921783All Organisms → cellular organisms → Bacteria → Terrabacteria group1490Open in IMG/M
3300019356|Ga0173481_10543105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300025321|Ga0207656_10053440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1753Open in IMG/M
3300025899|Ga0207642_10014270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2927Open in IMG/M
3300025900|Ga0207710_10185759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1022Open in IMG/M
3300025904|Ga0207647_10326329All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300025919|Ga0207657_10055487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3421Open in IMG/M
3300025925|Ga0207650_10245925All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta americana1447Open in IMG/M
3300025931|Ga0207644_11531226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300025931|Ga0207644_11822043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia509Open in IMG/M
3300025937|Ga0207669_10293212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1233Open in IMG/M
3300025938|Ga0207704_10925812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales734Open in IMG/M
3300025938|Ga0207704_11294339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter623Open in IMG/M
3300025949|Ga0207667_11242558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter723Open in IMG/M
3300025972|Ga0207668_10416671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1139Open in IMG/M
3300025981|Ga0207640_11918898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter536Open in IMG/M
3300025981|Ga0207640_12185832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter502Open in IMG/M
3300026035|Ga0207703_10060829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3090Open in IMG/M
3300026035|Ga0207703_10165447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1940Open in IMG/M
3300026067|Ga0207678_10497212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1063Open in IMG/M
3300026075|Ga0207708_10069213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2702Open in IMG/M
3300026089|Ga0207648_11027691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter772Open in IMG/M
3300026116|Ga0207674_10656981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter1012Open in IMG/M
3300026118|Ga0207675_101694254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter652Open in IMG/M
3300026121|Ga0207683_10227947All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300027907|Ga0207428_10584364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter806Open in IMG/M
3300028380|Ga0268265_10058232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2949Open in IMG/M
3300028381|Ga0268264_10042411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3766Open in IMG/M
3300028587|Ga0247828_10021695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2525Open in IMG/M
3300028589|Ga0247818_11033552Not Available582Open in IMG/M
3300028592|Ga0247822_11841729Not Available517Open in IMG/M
3300028596|Ga0247821_11184245Not Available519Open in IMG/M
3300030511|Ga0268241_10088934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium705Open in IMG/M
3300031901|Ga0307406_11275764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter640Open in IMG/M
3300031938|Ga0308175_103203051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter508Open in IMG/M
3300031996|Ga0308176_12474951Not Available553Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil10.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere10.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere7.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere7.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.36%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.45%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.73%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_1005720553300001686SoilMPSTSPEHSFCYVASDVPVGMTLSAWRGDKVRAEGGGRRSGLLRRRGR*
C688J18823_1011449833300001686SoilARQRRGCRIGAASPRRDTGPMPSTSPDHSFSYVESDVPAGMTLSSWRDEKVRAEAGGRRSGLLRRRAR*
C688J18823_1056950723300001686SoilMGEVPRGRDTASMLSITAAHSFCYVESDVPAGMTLSSWRGQKVHAEAGGRRPGLLRRRGR
C688J35102_11970943313300002568SoilMPSHPSSHSFLYVESDVPAGMTLSSWRDEKARAESRGRRSGFLRRLGGR*
C688J35102_11978181423300002568SoilMPSTTPEHTFSYVDCDVPAGMTLSSWRDEKVRATARGRRSGLLRR
C688J35102_12032226423300002568SoilMGAGLPRPDTEPMPSTTQDHTFCYVESDVPAGMTLSAWRSEKVRAETGGRRSGLLRRRGR
C688J35102_12048710323300002568SoilMPSTTAEHTFSYVDSDVPAGMTLTCWRDEKVRAAARGRRSGLLRRRGR*
C688J35102_12092231043300002568SoilMPSTTPEHTFCYVETDVPAGMTLSSWRDEKVRAEARGRRSGLLRRRGR*
C688J35102_12095263043300002568SoilMPSTSPDHSFSYVESDVPAGMTLSSWRDEKVRAEAGGRRSGLLRRRAR*
C688J35102_12096209533300002568SoilMPSTTPEHSFCYVESDVPVGMTLSAWRGEKVRAEPSGRRSGLLRRRGR*
Ga0063454_10139030623300004081SoilTQDHTFCYVESDVPAGMTLSAWRSEKVRAETGGRRSGLLRRRGR*
Ga0062593_10332756723300004114SoilMPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLLRRRGR*
Ga0063356_10015668423300004463Arabidopsis Thaliana RhizosphereMPSTTPEHTFCYVESDVPAGMTLSSWRSEKVRAQAGGRRSGVLRRRGR*
Ga0062595_10024988213300004479SoilMPAVTPDHSFCYVESDVPAGMTLSSWRGEKARAEARGRRSGLLRRRGR*
Ga0062595_10234129313300004479SoilPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0062592_10249983513300004480SoilMGAIARRRDTAPMPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLLRRRGR
Ga0062594_10203594113300005093SoilTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR*
Ga0070683_10106998923300005329Corn RhizospherePRKVAYSPSPTRACRMGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR*
Ga0070683_10116773423300005329Corn RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR*
Ga0070670_10181819113300005331Switchgrass RhizosphereMGAAPSRRDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR
Ga0068869_10187615123300005334Miscanthus RhizosphereMGAAPPRQDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGVLRRRGR
Ga0070680_10094673323300005336Corn RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRGEKVRAEAGGRRAGVLRRRG
Ga0070682_10060890013300005337Corn RhizosphereDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0070682_10124196513300005337Corn RhizosphereASMPPTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGPRRRRGR*
Ga0068868_10013787723300005338Miscanthus RhizosphereMPSTSPEHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR*
Ga0068868_10025559723300005338Miscanthus RhizosphereMPSTSPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0070660_10065198323300005339Corn RhizosphereMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR
Ga0070691_1079181823300005341Corn, Switchgrass And Miscanthus RhizosphereMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0070661_10119421823300005344Corn RhizosphereMGAIARRRDTASMPPTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR
Ga0070668_10225256813300005347Switchgrass RhizosphereDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR*
Ga0070671_10164419823300005355Switchgrass RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPHRRSGVLRRRGR*
Ga0070674_10093680923300005356Miscanthus RhizosphereMGAAPPRQDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAESGGRRSGLLRRRGR
Ga0070710_1071151223300005437Corn, Switchgrass And Miscanthus RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEAVGRRSGVLRRRGR*
Ga0070700_10139251413300005441Corn, Switchgrass And Miscanthus RhizosphereFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR*
Ga0070663_10026146523300005455Corn RhizosphereMGAIARRRDTAPMPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR
Ga0070663_10182918123300005455Corn RhizosphereDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGVLRRRGR*
Ga0070678_10076666423300005456Miscanthus RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR*
Ga0070662_10059376413300005457Corn RhizospherePDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR*
Ga0068867_10010288323300005459Miscanthus RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0070685_1052858323300005466Switchgrass RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRGR*
Ga0068853_10087209523300005539Corn RhizosphereMGAAPPRRDTAPMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0070686_10039064613300005544Switchgrass RhizosphereHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRGR*
Ga0068855_10146402423300005563Corn RhizosphereMGAAAPRRDTAPMPSTSPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR
Ga0070664_10013521233300005564Corn RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR*
Ga0068854_10061267723300005578Corn RhizosphereAPTRACRMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0070702_10041631123300005615Corn, Switchgrass And Miscanthus RhizosphereMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAVAGGRRSGVLRRRGR
Ga0070702_10173670913300005615Corn, Switchgrass And Miscanthus RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRGEKVRAEAGGRRSGVLRRRGR*
Ga0068852_10098908823300005616Corn RhizosphereMPSTSPAHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR*
Ga0068851_1053454313300005834Corn RhizospherePDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0068862_10020688723300005844Switchgrass RhizosphereMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR
Ga0079222_1110051123300006755Agricultural SoilMPSIAPELTFSYVESDVPAGMTLSSWRGEKVRAESRRRRDGLVRRHGR*
Ga0075428_10151257423300006844Populus RhizosphereMAAAAPRRDTAPMPAAIPDHTFRYVESDVPAGMTLSSWRGEKVRAEARSRRSGLLRRRGR
Ga0075425_10133903123300006854Populus RhizospherePTRGCRMGAAPPRRDTAPMPSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR*
Ga0075434_10071497413300006871Populus RhizosphereRACRMGAAPPRRDTAPMLSTTPDHTFRYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR*
Ga0097620_10133141513300006931Switchgrass RhizosphereDHTFCYVESDVPAGMTLSSWRSEKVRAVAGGRRSGVLRRRGR*
Ga0079219_1154765413300006954Agricultural SoilTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR*
Ga0111539_1089169913300009094Populus RhizosphereMGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSGRADKARAEAGARRSGLRRRRGR
Ga0111539_1137779213300009094Populus RhizosphereMLSTTLEYTFCYVESDVPAGMTLSSWRGEKVRAEGRGRRSGLLRRRGR*
Ga0105243_1170589623300009148Miscanthus RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR*
Ga0111538_1129887823300009156Populus RhizosphereMPAAIPDHTFRYVESDVPAGMTLSSWRGEKVRAEARSRRSGLLRRRGR*
Ga0105241_1162150723300009174Corn RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGVLRRRGR*
Ga0105242_1205779413300009176Miscanthus RhizosphereDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR*
Ga0134127_1099617023300010399Terrestrial SoilMPSTSPSHTFSYVESDVAEGMTLSAWRAEKVRSEAGGRRSGLLRRRGR*
Ga0150985_10114162123300012212Avena Fatua RhizosphereMLSITAAHSFCYVESDVPAGMTLSSWRGEKVRAEAGGRRPGLLRRRGR*
Ga0150985_11071885513300012212Avena Fatua RhizosphereTPEHSFCYVESDVPVGMTLSAWRGEKVRAEPSGRRSGLLRRRGR*
Ga0150984_11401427413300012469Avena Fatua RhizosphereSPDHSFSYVESDVPAGMTLSSWRDEKVRAEAGGRRSGLLRRRAR*
Ga0150984_11485521113300012469Avena Fatua RhizosphereGAEHSFCYVESDVPVGMTLSAWRGEKVRAEPSGRRSGLLRRRGR*
Ga0157371_1110967023300013102Corn RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR*
Ga0157374_1009823413300013296Miscanthus RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR*
Ga0163162_1080365113300013306Switchgrass RhizosphereMPAVTPDHTFCYVESDVPAGMTLSSWRGEKARAEARGRRSGLLRRRGR*
Ga0157380_1014424723300014326Switchgrass RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAVAGGRRSGVLRRRGR*
Ga0157376_1145395113300014969Miscanthus RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSG
Ga0157376_1165949223300014969Miscanthus RhizosphereMPSTSPDHTFCYVDSDVPAGMTLSSWRSEKVRAEGRGRRSGVLRRRGR*
Ga0132258_1054425343300015371Arabidopsis RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGVLRRRGR*
Ga0132258_1192178323300015371Arabidopsis RhizosphereMASTTPEHSFSYVESDVPAGMTLSAWRGDRVRAEAGDRRSGLLRRRGR*
Ga0173481_1054310523300019356SoilMPSTSPSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLLRRRGR
Ga0207656_1005344023300025321Corn RhizosphereMPSTSPEHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR
Ga0207642_1001427053300025899Miscanthus RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR
Ga0207710_1018575923300025900Switchgrass RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0207647_1032632923300025904Corn RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVR
Ga0207657_1005548723300025919Corn RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0207650_1024592523300025925Switchgrass RhizosphereMGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR
Ga0207644_1153122613300025931Switchgrass RhizosphereAAAPRRETPPMPTATPEHTFCYVDCDVPAGMTLSSWRGEKVRAAARGRRSGFLRRRGR
Ga0207644_1182204313300025931Switchgrass RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPHRRSGVLRRRGR
Ga0207669_1029321213300025937Miscanthus RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRS
Ga0207704_1092581223300025938Miscanthus RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRGEKVRAEAGGRRSGVLRRRGR
Ga0207704_1129433923300025938Miscanthus RhizosphereESDVPAGMTLSSWRSEKVRAAAGGRRSGVFRRRGR
Ga0207667_1124255823300025949Corn RhizosphereMPSTSPDHAFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR
Ga0207668_1041667113300025972Switchgrass RhizosphereTAPTRACRMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRDR
Ga0207640_1191889823300025981Corn RhizosphereSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR
Ga0207640_1218583223300025981Corn RhizosphereAPPRRDTAPMLSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0207703_1006082913300026035Switchgrass RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGG
Ga0207703_1016544733300026035Switchgrass RhizosphereCRMGAAAPRRDTAPMPSTSPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0207678_1049721223300026067Corn RhizosphereMGAIARRRDTASMPSTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGMRRRRGR
Ga0207708_1006921323300026075Corn, Switchgrass And Miscanthus RhizosphereMLSTTPDHTFCYVESDVPAGMTLSSWRSEKARAQGGRRRSGVLRRRAR
Ga0207648_1102769113300026089Miscanthus RhizosphereMPSTSPAHSFSYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR
Ga0207674_1065698123300026116Corn RhizosphereMGAIARRRDTASMPPTSLSHTFCYVESDVPAGMTLSSWRAEKARAEAGARRSGLRRRRGR
Ga0207675_10169425423300026118Switchgrass RhizosphereYVESDVPAGMTLSAWRGEKVRAEARGRRSGLFRRRGR
Ga0207683_1022794743300026121Miscanthus RhizosphereMPSTTPDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0207428_1058436413300027907Populus RhizospherePDHTFCYVESDVPAGMTLSSWRSEKTRAQAPRRRSGVLRRRGR
Ga0268265_1005823233300028380Switchgrass RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRRSGMFRRRGR
Ga0268264_1004241113300028381Switchgrass RhizosphereMPSTSPDHTFCYVESDVPAGMTLSSWRSEKVRAAAGGRR
Ga0247828_1002169513300028587SoilPDHTFCYVESDVPAGMTLSSWRSEKVRAESGGRRSGLLRRRGR
Ga0247818_1103355223300028589SoilMPSTTPEHSFCYVESDVPAGMTLSAWRGEKARAEVSGRRSGLLRRRAR
Ga0247822_1184172913300028592SoilMGAASLRRDTAPMPSTTPDHAFCYVESDVPAGMTLSTWRGEKVRAEAGGRRSGMFRRRGR
Ga0247821_1118424513300028596SoilMPSTTPDHAFCYVESDVPAGMTLSTWRGEKVRAEAGGRRSGMFRRRGR
Ga0268241_1008893413300030511SoilMPSASPDHTFCYVESDVPAGMTLSSWRSEKVRAEARGRRSGLLRRRPRGH
Ga0307406_1127576423300031901RhizospherePMPSTTPDHTFCYVESDVPAGMTLSSWRSEKVRAEAHGRRRGVLRRRGR
Ga0308175_10320305123300031938SoilMPSITPEHTFCYVESDVPAGVTLSSWRGEKVRAEAGGRRSGLLRRRGN
Ga0308176_1247495113300031996SoilMPSIASQHTFCYVESDVPAGMTLSSWRGEKVRVEARRRRSRLLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.