NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086956

Metagenome / Metatranscriptome Family F086956

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086956
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 45 residues
Representative Sequence MKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKRL
Number of Associated Samples 101
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.06 %
% of genes near scaffold ends (potentially truncated) 98.18 %
% of genes from short scaffolds (< 2000 bps) 92.73 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.909 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(18.182 % of family members)
Environment Ontology (ENVO) Unclassified
(25.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.455 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.85%    β-sheet: 0.00%    Coil/Unstructured: 59.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00990GGDEF 75.45
PF00300His_Phos_1 4.55
PF00578AhpC-TSA 1.82
PF00326Peptidase_S9 0.91



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.91 %
UnclassifiedrootN/A9.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101600416All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria549Open in IMG/M
3300005363|Ga0008090_10112793All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1773Open in IMG/M
3300005406|Ga0070703_10113147All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300005435|Ga0070714_100931326All Organisms → cellular organisms → Bacteria → Proteobacteria844Open in IMG/M
3300005435|Ga0070714_101891843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium582Open in IMG/M
3300005560|Ga0066670_10282149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1009Open in IMG/M
3300005586|Ga0066691_10238672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1066Open in IMG/M
3300005764|Ga0066903_108206419All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium534Open in IMG/M
3300005921|Ga0070766_10808046Not Available639Open in IMG/M
3300006034|Ga0066656_10207354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1249Open in IMG/M
3300006102|Ga0075015_100873474All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006791|Ga0066653_10546526All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium586Open in IMG/M
3300006797|Ga0066659_11846599All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium512Open in IMG/M
3300009093|Ga0105240_10256928All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300009137|Ga0066709_100654004All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1505Open in IMG/M
3300009143|Ga0099792_11236700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300009174|Ga0105241_10422142All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1174Open in IMG/M
3300009174|Ga0105241_11006526All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium780Open in IMG/M
3300009177|Ga0105248_10844327All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1034Open in IMG/M
3300010321|Ga0134067_10136878All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium865Open in IMG/M
3300010322|Ga0134084_10086703All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium981Open in IMG/M
3300010360|Ga0126372_10751444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium959Open in IMG/M
3300010379|Ga0136449_104517016All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium511Open in IMG/M
3300010396|Ga0134126_10909090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium990Open in IMG/M
3300010398|Ga0126383_11816158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium698Open in IMG/M
3300010401|Ga0134121_10123707All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2186Open in IMG/M
3300010877|Ga0126356_11420204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium661Open in IMG/M
3300011269|Ga0137392_10943187All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria710Open in IMG/M
3300012202|Ga0137363_11449948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium577Open in IMG/M
3300012207|Ga0137381_11247344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium636Open in IMG/M
3300012361|Ga0137360_10357191All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1224Open in IMG/M
3300012361|Ga0137360_10916755Not Available755Open in IMG/M
3300012377|Ga0134029_1263978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium528Open in IMG/M
3300012683|Ga0137398_10352040All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria997Open in IMG/M
3300012683|Ga0137398_10589376All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium768Open in IMG/M
3300012971|Ga0126369_12086317All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium655Open in IMG/M
3300013296|Ga0157374_10663361Not Available1055Open in IMG/M
3300015357|Ga0134072_10007572All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2432Open in IMG/M
3300015372|Ga0132256_100422101All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1438Open in IMG/M
3300015374|Ga0132255_104139912All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium615Open in IMG/M
3300016294|Ga0182041_10285841All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1360Open in IMG/M
3300016294|Ga0182041_10302023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1327Open in IMG/M
3300016341|Ga0182035_11362362All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium636Open in IMG/M
3300016371|Ga0182034_11515978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium587Open in IMG/M
3300016404|Ga0182037_10538733All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium984Open in IMG/M
3300016422|Ga0182039_10962848All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium764Open in IMG/M
3300017994|Ga0187822_10058225All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1102Open in IMG/M
3300018034|Ga0187863_10684870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium579Open in IMG/M
3300018064|Ga0187773_10121674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1313Open in IMG/M
3300020579|Ga0210407_10089149All Organisms → cellular organisms → Bacteria2333Open in IMG/M
3300021372|Ga0213877_10291461All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium551Open in IMG/M
3300021402|Ga0210385_10590346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium847Open in IMG/M
3300021441|Ga0213871_10050959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1134Open in IMG/M
3300021477|Ga0210398_10671539All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium839Open in IMG/M
3300021559|Ga0210409_10056586All Organisms → cellular organisms → Bacteria → Proteobacteria3675Open in IMG/M
3300021560|Ga0126371_12020929All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria693Open in IMG/M
3300021560|Ga0126371_12318734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium649Open in IMG/M
3300025898|Ga0207692_10988263Not Available555Open in IMG/M
3300025906|Ga0207699_10401033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium977Open in IMG/M
3300025921|Ga0207652_10976753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium745Open in IMG/M
3300025924|Ga0207694_11893426All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium500Open in IMG/M
3300025929|Ga0207664_10887252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium801Open in IMG/M
3300025986|Ga0207658_12081141All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium516Open in IMG/M
3300026318|Ga0209471_1245194All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria622Open in IMG/M
3300026323|Ga0209472_1104480All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1127Open in IMG/M
3300026979|Ga0207817_1036841Not Available517Open in IMG/M
3300027505|Ga0209218_1137421All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium516Open in IMG/M
3300027591|Ga0209733_1071150All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium901Open in IMG/M
3300027671|Ga0209588_1208731All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium607Open in IMG/M
3300027676|Ga0209333_1216268All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium502Open in IMG/M
3300027727|Ga0209328_10082234All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium985Open in IMG/M
3300027895|Ga0209624_10513362All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium798Open in IMG/M
3300028906|Ga0308309_11470935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium582Open in IMG/M
3300030490|Ga0302184_10439272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium502Open in IMG/M
3300030646|Ga0302316_10415703Not Available540Open in IMG/M
3300030693|Ga0302313_10181847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium850Open in IMG/M
3300031090|Ga0265760_10316994All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium554Open in IMG/M
3300031128|Ga0170823_12916142Not Available969Open in IMG/M
3300031561|Ga0318528_10214844All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1030Open in IMG/M
3300031561|Ga0318528_10659614All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium560Open in IMG/M
3300031616|Ga0307508_10625108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium680Open in IMG/M
3300031713|Ga0318496_10587946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium615Open in IMG/M
3300031719|Ga0306917_11602471Not Available500Open in IMG/M
3300031720|Ga0307469_10445593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1119Open in IMG/M
3300031744|Ga0306918_10737734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium770Open in IMG/M
3300031748|Ga0318492_10055344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1863Open in IMG/M
3300031753|Ga0307477_10315341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1078Open in IMG/M
3300031754|Ga0307475_10263873All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1381Open in IMG/M
3300031765|Ga0318554_10279883All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium949Open in IMG/M
3300031779|Ga0318566_10322487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium764Open in IMG/M
3300031782|Ga0318552_10129067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1263Open in IMG/M
3300031796|Ga0318576_10637030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium502Open in IMG/M
3300031819|Ga0318568_10153390All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1409Open in IMG/M
3300031832|Ga0318499_10198127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium783Open in IMG/M
3300031845|Ga0318511_10076793All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1389Open in IMG/M
3300031894|Ga0318522_10148170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium884Open in IMG/M
3300031910|Ga0306923_10948180All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium939Open in IMG/M
3300031962|Ga0307479_10957438All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium827Open in IMG/M
3300032009|Ga0318563_10343145All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium808Open in IMG/M
3300032039|Ga0318559_10153924All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1045Open in IMG/M
3300032041|Ga0318549_10032212All Organisms → cellular organisms → Bacteria → Proteobacteria2072Open in IMG/M
3300032076|Ga0306924_10158165All Organisms → cellular organisms → Bacteria → Proteobacteria2596Open in IMG/M
3300032090|Ga0318518_10331689All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium781Open in IMG/M
3300032160|Ga0311301_12851488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300032180|Ga0307471_100300461Not Available1692Open in IMG/M
3300032261|Ga0306920_101872673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium844Open in IMG/M
3300032261|Ga0306920_103190891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium614Open in IMG/M
3300033412|Ga0310810_11150076All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium638Open in IMG/M
3300033480|Ga0316620_11066325All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium788Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.36%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.73%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.73%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.82%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.91%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.91%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.91%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.91%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012377Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026979Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10160041613300002245Forest SoilMKKTGSEPGTSPGEPLERARLQADVAKQRVRLAKDELKRARKRLKEAKREAK
Ga0008090_1011279313300005363Tropical Rainforest SoilMKKTASENSHPAESPERVRLQAEVAKQRVRIAKDELKRARK
Ga0070703_1011314723300005406Corn, Switchgrass And Miscanthus RhizosphereMKKTGGEQVSPAPSPDRARLQADVAKQRVRIAKEELKRARKRLKEAKREAK
Ga0070714_10093132613300005435Agricultural SoilMKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQRVRIAKEELKRARKRLKEAK
Ga0070714_10189184313300005435Agricultural SoilMKKTGSDNSSRGTEPAEGSQAEPIERARLQAEVARQRVRIAKEELKRARKRLKEAKRE
Ga0066670_1028214923300005560SoilMKKTGSEQSSPAEPLERARLQADVAKQRVRIAKEELKRARK
Ga0066691_1023867213300005586SoilMKKTGSEARLEPAAHSEDAPAEPIERARLQADVAKQGVRLAKEELKRARKR
Ga0066903_10820641913300005764Tropical Forest SoilMKKTGSEHGTPTEPLARARLQADVAKQRVRIAKDELKRARKRLKEAKREAKRA
Ga0070766_1080804613300005921SoilMKKTGSEIAPDEAVQSKAAPAEPVERARLQADVAKQRVRIAKEELKRA
Ga0066656_1020735413300006034SoilMKKTGSEQVTPAEPLERARLQAEVAKQRVRIAKEELKRAPRAK
Ga0075015_10087347413300006102WatershedsMKKTGSEIAPDGSEQSKAPPAEPVERARLQADVAKQRVRIAKEELKRARKRLKEAKR
Ga0066653_1054652623300006791SoilMKKTGSEQSSPAEPLERARLQADVAKQRVRIAKEELKRARKGL
Ga0066659_1184659923300006797SoilMKKTGSEARTETAAYSEDAPAEPIERARLQADVAKQGVRLAKEELK
Ga0105240_1025692813300009093Corn RhizosphereMKKTGSETPANDSKKSEAAPAEPVERTRLQADVAKQRVRIAKEELKRAR
Ga0066709_10065400433300009137Grasslands SoilMKKTGSEQNSPAEPLERARLQADVAKQRVRIAKEELKR
Ga0099792_1123670023300009143Vadose Zone SoilMKKTGSEQNTPAEPLEPARLQAEVAKQRVRIAKEELKRARKRLKEAK
Ga0105241_1042214233300009174Corn RhizosphereMKKTGSEPLSSATPFERARLLADVAKQRVRIAKEEL
Ga0105241_1100652623300009174Corn RhizosphereMKKTGGEQVSSALPPERARLQADVAKQRVRIAKDELKRARKRIKEAKSEA
Ga0105248_1084432723300009177Switchgrass RhizosphereMKKTGSETPSDPSEKNKAAATEPVERARLQADISKQRVRIAKEELKRARKR
Ga0105248_1292552013300009177Switchgrass RhizosphereMKKTGTETASAEIIDRAQLQADVARQRVRLAKDELHRARKRLKEAK
Ga0134067_1013687823300010321Grasslands SoilMKKTGSEQDTPAEPLERARLQAEVAKQRVRIAKEELKRARKRLKEAK
Ga0134084_1008670323300010322Grasslands SoilMKKTGSEQDAPAEPLERARLQAEVAKQRVRIAKEELKRA
Ga0126372_1075144413300010360Tropical Forest SoilMKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRA
Ga0136449_10451701623300010379Peatlands SoilMKKSGSEPSDLPAEPLERARLQAEVARQRVRIAKE
Ga0134126_1090909023300010396Terrestrial SoilMKKTGSEQVTPAPPLERARLQADVAKQRVRIAKDELKRARKRLKEAKREAKR
Ga0126383_1181615813300010398Tropical Forest SoilMKKTGSEHGTPTEPLARARLQADVAKQRVRIAKDELKRARKRLKEAKRE
Ga0134121_1012370713300010401Terrestrial SoilMKKTGSEQSSTAEPLERVRLQADVAKQRVRIAKDELKRARKRLKEAKR
Ga0126356_1142020423300010877Boreal Forest SoilMKKTGSEIAPDESEQSKAPPAEPVERARLQADVAKQRVRIAKEELKR
Ga0137392_1094318713300011269Vadose Zone SoilMKKTGSEARLETAAHGEDAPAEPIERARLHADVAKQRVRLAKEELKRA
Ga0137363_1144994823300012202Vadose Zone SoilMKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKRLKEAK
Ga0137381_1124734423300012207Vadose Zone SoilMKKTGSEQDTPAEPLERARLQAEVAKQRVRIAKEELKRARKRLKEAKREAR
Ga0137360_1035719113300012361Vadose Zone SoilMKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKR
Ga0137360_1091675523300012361Vadose Zone SoilMKKTGSEARIETAAHSGDTAAEPIERARLQADVAKQRVRLAKE
Ga0134029_126397813300012377Grasslands SoilMKKTGSEQSSPAEPLERARLQADVAKQRVRIAKEELKRARKGLKEAKR
Ga0137398_1035204023300012683Vadose Zone SoilMKKTGSEQNTPAEPLEPARLQAEVAKQRVRIAKEELKRARKRLKEAKRE
Ga0137398_1058937613300012683Vadose Zone SoilMKKTGSEQDSPAEPLERARLQADVAKQRVRIAKEE
Ga0126369_1208631723300012971Tropical Forest SoilMKKTGSEKETPAEPFGRARLLADVAKQRVRIAKEELKRARK
Ga0157374_1066336123300013296Miscanthus RhizosphereMKKTGSETPAIETEQTQAAPAEPVERARLQADVAKQRVRIAKEELKRARKRLK
Ga0134072_1000757213300015357Grasslands SoilMKKTGSEQDAPAEPLERARLQAEVAKQRVRIAKEELKRAPRAKRRPVARRAAAAQR
Ga0132256_10042210123300015372Arabidopsis RhizosphereMKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRARK
Ga0132255_10413991213300015374Arabidopsis RhizosphereMKKTGSEPLSSATPFERARLLADVAKQRVRIAKEELKRARKRLKEAKREARRA
Ga0182041_1028584123300016294SoilMKKIASENGPPAESPERVRLQADVAKQRVRIAKDELKRAR
Ga0182041_1030202323300016294SoilMKKTGSDHGAPAEPLERVRLQAEVAKQRVRIAKDELKRARKRLKEAK
Ga0182035_1136236223300016341SoilMKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRARKRLKEA
Ga0182034_1151597813300016371SoilMKKNSSGQDPPAEPLDRVRLQAEVARQRVRIAKDELKRARKRLKE
Ga0182037_1053873323300016404SoilMKKTGSDHGAPAEPLERVRLQAEVARQRVRIAKDELKRARKRLK
Ga0182039_1096284813300016422SoilMKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELKRARKRLKEAKR
Ga0187822_1005822523300017994Freshwater SedimentMKKSGSEPSLPAEPLERARLQAEVAKQRVRIAKDELKRARKRLKEAKREAK
Ga0187863_1068487013300018034PeatlandMKKTGSEQNAPAEPFERARLQAEVGKQRVRIAKEE
Ga0187773_1012167423300018064Tropical PeatlandMKKTGSEPQDLPAEPIERARLQADVAKQRVRIAKDELKRARKRLKEAKREAKRA
Ga0210407_1008914943300020579SoilMKKTGSEPAPAEPFERIRLQADVAKQRVRIAKEEL
Ga0213877_1029146123300021372Bulk SoilMKKSGSETAKLPAEPLERARLQAEVAKQRVRIAKDELKRARKR
Ga0210385_1059034623300021402SoilMKKTGSEIAPDEAVQSKAAPAEPVERARLQADVAKQRVRIAKEELKRARKRLKEAKRE
Ga0213871_1005095923300021441RhizosphereMKKTGNVQSVPAVPRGHARLFADVAKQRVRIAKDELKR
Ga0210398_1067153923300021477SoilMKKSGSEPSDLPAEPLERARLQAEVAKQRVRIAKEELKRARKRL
Ga0210409_1005658613300021559SoilMKKSGGEPATFPAEPLERARLQAEVAKQRVRIAKDELKRARKRLKEAKRE
Ga0126371_1202092923300021560Tropical Forest SoilMKKSDSEPADLPAEPLERARLQAEVAKQRVRIAKDELK
Ga0126371_1231873423300021560Tropical Forest SoilMKKTGSDHVSAAEPLERVRLQADVSKQRVRIAKDELKRARKRLKEAKREA
Ga0207692_1098826313300025898Corn, Switchgrass And Miscanthus RhizosphereMKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQRVRIAKEELKRARK
Ga0207699_1040103313300025906Corn, Switchgrass And Miscanthus RhizosphereMKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQR
Ga0207652_1097675323300025921Corn RhizosphereMKKTGSDNSPRGTEPADGSQAEPIERARLQAEVAKQRVRIAKEELKRARKRL
Ga0207694_1189342623300025924Corn RhizosphereMKKTGSAEASPGSSSSADAAAPAEPVERARLQAEVAKQRVRIAKEELKRARKRVKE
Ga0207664_1088725223300025929Agricultural SoilMKKTGSETPANDSEKSKAAPAEPVERTRLQADVAKQRVRIAKEELK
Ga0207658_1208114123300025986Switchgrass RhizosphereMKKTGSEPPLEAANGQDTPAEPIERARLQAEVAKQRV
Ga0209471_124519423300026318SoilMKKTGSEQNTPAEPLEPARLQAEVAKQRVRIAKEELKRARK
Ga0209472_110448013300026323SoilMKKTGSEQDAPAEPLERARLQAEVAKQRVRIAKEELKRARKRLKEAK
Ga0207817_103684113300026979Tropical Forest SoilMKKTGSEQHISAEPLERVRLQADVAKQRVRIAKEELKRARKRLKGTRDAAGEEDDEN
Ga0209218_113742123300027505Forest SoilMKKPSSEQSNSSEPIARARLQADVAKQRVRIAKDELK
Ga0209733_107115013300027591Forest SoilMKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEELKRARKRL
Ga0209588_120873113300027671Vadose Zone SoilMKKTGSEQDTPAEPLERARLQADVAKQRVRIAKEE
Ga0209333_121626813300027676Forest SoilMKKTSSESAPTVPAERAKLEAEVAKQRVRLAKEELKRARKRLKEA
Ga0209328_1008223413300027727Forest SoilMKKTGSEQVTPAEPLERARLQADVAKQRVRIAKEELKRARKRL
Ga0209624_1051336223300027895Forest SoilMKKTASEQDTPVEPLERARLQADVAKQRVRIAKEE
Ga0308309_1147093513300028906SoilMKKTGSEQNAPAEPFERARLQADVAKQRVRIAKEELKRARKRLKEA
Ga0302184_1043927213300030490PalsaMKKTGSEQNAPAEPSERARLQADVAKQRVRIAKEELKRARKRLKEA
Ga0302316_1041570313300030646PalsaMKKTGSEIAPDEAIQSKTAPAEPVERARLQADVAKQRVRIAKEELKRARKRLKEAKR
Ga0302313_1018184723300030693PalsaMKKTGSEQNAPAEPSERARLQADVAKQRVRIAKEELKRARKRLKEAKRE
Ga0265760_1031699413300031090SoilMKKTASEQDTPVEPLERARLQADVAKQRVRIAKEELKRARKRLKEAKR
Ga0170823_1291614223300031128Forest SoilMKKTGSEIAPDEAVQSKAAPAEPVERARLQADVAKQRVRIAKEELKRAASA
Ga0318528_1021484413300031561SoilMKKTGSEQPSQAEPLERARLQADVAKQRVRLAKDELK
Ga0318528_1065961423300031561SoilMKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDELKRARKRL
Ga0307508_1062510813300031616EctomycorrhizaMKKTGSEIAPDESEQSKAPPAEPVERARLQADVAKQRVRIAKEELKRARKR
Ga0318496_1058794623300031713SoilMKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDELKRARKR
Ga0306917_1160247113300031719SoilMKKTGSEQTTPAEPLERARLQADVAKQRVRIAKEELKRARK
Ga0307469_1044559323300031720Hardwood Forest SoilMKKTGSEQNPPAEPLERARLQADVAKQRVRIAKEELKRARRRLKEAK
Ga0306918_1073773413300031744SoilMKKTASDPDSAAEPLDRVRLQADVSKQRVRIAKDELKRARKRLKEAKREAKR
Ga0318492_1005534433300031748SoilMKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELK
Ga0307477_1031534133300031753Hardwood Forest SoilMKKTGSEQDTPAEPLERARLQAEVARQRVRIAKEE
Ga0307475_1026387323300031754Hardwood Forest SoilMKKTGSEIPSDEPEKSKAAPAEPERARLQADVAKQRVRIAKEE
Ga0318554_1027988323300031765SoilMKKTASENGPSAESPERVRLQADVAKQRVRIAKDELKRARKRLKEAKRE
Ga0318566_1032248713300031779SoilMKKNSSGQDPPAEPLDRVRLQAEVARQRVRIAKDEL
Ga0318552_1012906723300031782SoilMKKTGSDHGAPAEPLERVRLQAEVAKQRVRIAKDELKRARKRLKEAKREAKR
Ga0318576_1063703013300031796SoilMKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDELKRA
Ga0318568_1015339013300031819SoilMKKTASDPDSAAEPLDRVRLQADVSKQRVRIAKDEL
Ga0318499_1019812713300031832SoilMKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELKRARKRLK
Ga0318511_1007679313300031845SoilMKKTASENGPSAESPERVRLQADVAKQRVRIAKDELKRARKRLK
Ga0318522_1014817013300031894SoilMKKTASENGPPAESPERVRLQADVAKQRVRIAKDELKRARKRLK
Ga0306923_1094818023300031910SoilMKKTGSEQPSPAEPLERARLQADVAKQRVRLAKDELKR
Ga0307479_1095743823300031962Hardwood Forest SoilMKKTGSAQHSTAEPLQRVRLQADVAKQRVRIAKDELKR
Ga0318563_1034314513300032009SoilMKKTASDPDSAAEPLDRVRLQADVSKQRVRIAKDELKRARKRLK
Ga0318559_1015392413300032039SoilMKKIASENGPPAESPERVRLQADVAKQRVRIAKDELK
Ga0318549_1003221213300032041SoilMKKTGSDHDSAAEPLGRVRLQADVAKQRVRIAKDELKRARKRLKEAK
Ga0306924_1015816513300032076SoilMKKTGSEQKSTGEPLARVRLQADVAKQRVRIAKDEL
Ga0318518_1033168913300032090SoilMKKTGSEQPSQAEPLERARLQADVAKQRVRLAKDELKRARKGLK
Ga0311301_1285148823300032160Peatlands SoilMKKSGSEPSDLPAEPLERARLQAEVARQRVRIAKEELKRARKRLKEAK
Ga0307471_10030046113300032180Hardwood Forest SoilMKKTASEQVTPAEPLERARLQADVAKQRVRIAKEELKRARKRLKEAKR
Ga0306920_10187267313300032261SoilMKKTGSEHDAAAEPPERVRLQAEVARQRVRIAKDELKRARKRLKEAKREAKR
Ga0306920_10319089123300032261SoilMKKTGSEPGPADARAVLQADVAKQRVRIAKEELKRARKRLKEAKREARRA
Ga0310810_1115007623300033412SoilMKKTGSAQGSAAEPLERVRLQADVAKQRVRIAKDELKRARKRLKEAKREAR
Ga0316620_1106632513300033480SoilMKKTGSEQNAPTEPFERARLQADVAKQRVRIAKEELKRARKRLKEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.