NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086762

Metagenome Family F086762

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086762
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 45 residues
Representative Sequence EEKRFDEIGWAKDIREALRLAKQHNRPVFLFTHDGRMNIGRC
Number of Associated Samples 97
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 90.00 %
% of genes from short scaffolds (< 2000 bps) 89.09 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.909 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(14.546 % of family members)
Environment Ontology (ENVO) Unclassified
(35.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.273 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.71%    β-sheet: 0.00%    Coil/Unstructured: 84.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF02518HATPase_c 1.82
PF14060DUF4252 0.91
PF12697Abhydrolase_6 0.91
PF07075DUF1343 0.91
PF00144Beta-lactamase 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.91
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.91
COG2367Beta-lactamase class ADefense mechanisms [V] 0.91
COG3876Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 familyCell wall/membrane/envelope biogenesis [M] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.91 %
UnclassifiedrootN/A9.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100442679All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300004082|Ga0062384_100707496All Organisms → cellular organisms → Bacteria → PVC group694Open in IMG/M
3300004156|Ga0062589_100454285All Organisms → cellular organisms → Bacteria → PVC group1062Open in IMG/M
3300004463|Ga0063356_101962991All Organisms → cellular organisms → Bacteria → PVC group884Open in IMG/M
3300005175|Ga0066673_10190421All Organisms → cellular organisms → Bacteria → PVC group1165Open in IMG/M
3300005179|Ga0066684_10248751All Organisms → cellular organisms → Bacteria → PVC group1166Open in IMG/M
3300005186|Ga0066676_10724414All Organisms → cellular organisms → Bacteria → PVC group677Open in IMG/M
3300005295|Ga0065707_11008436All Organisms → cellular organisms → Bacteria → PVC group537Open in IMG/M
3300005332|Ga0066388_104340226All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19723Open in IMG/M
3300005332|Ga0066388_105310264All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15653Open in IMG/M
3300005332|Ga0066388_106772316All Organisms → cellular organisms → Bacteria → PVC group577Open in IMG/M
3300005332|Ga0066388_107849185All Organisms → cellular organisms → Bacteria → PVC group534Open in IMG/M
3300005334|Ga0068869_101099389All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae695Open in IMG/M
3300005338|Ga0068868_102298761All Organisms → cellular organisms → Bacteria → PVC group514Open in IMG/M
3300005458|Ga0070681_10712818All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae919Open in IMG/M
3300005459|Ga0068867_101871010All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium565Open in IMG/M
3300005471|Ga0070698_101035142All Organisms → cellular organisms → Bacteria → PVC group769Open in IMG/M
3300005545|Ga0070695_100713941All Organisms → cellular organisms → Bacteria → PVC group797Open in IMG/M
3300005549|Ga0070704_100234031All Organisms → cellular organisms → Bacteria → PVC group1500Open in IMG/M
3300005558|Ga0066698_10816456All Organisms → cellular organisms → Bacteria → PVC group603Open in IMG/M
3300005558|Ga0066698_11000392All Organisms → cellular organisms → Bacteria → PVC group531Open in IMG/M
3300005560|Ga0066670_10699285All Organisms → cellular organisms → Bacteria → PVC group614Open in IMG/M
3300005618|Ga0068864_101492207All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium679Open in IMG/M
3300005764|Ga0066903_103456507All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19852Open in IMG/M
3300005764|Ga0066903_107259765All Organisms → cellular organisms → Bacteria → PVC group573Open in IMG/M
3300005764|Ga0066903_108709167All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15516Open in IMG/M
3300005842|Ga0068858_100748556All Organisms → cellular organisms → Bacteria → PVC group952Open in IMG/M
3300006844|Ga0075428_102064456All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15590Open in IMG/M
3300006845|Ga0075421_101737072All Organisms → cellular organisms → Bacteria → PVC group673Open in IMG/M
3300006847|Ga0075431_101942701All Organisms → cellular organisms → Bacteria → PVC group544Open in IMG/M
3300006854|Ga0075425_102128279All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15626Open in IMG/M
3300006881|Ga0068865_101132100All Organisms → cellular organisms → Bacteria → PVC group690Open in IMG/M
3300007265|Ga0099794_10751237All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp.521Open in IMG/M
3300009012|Ga0066710_100994710All Organisms → cellular organisms → Bacteria → PVC group1294Open in IMG/M
3300009012|Ga0066710_101952751All Organisms → cellular organisms → Bacteria → PVC group874Open in IMG/M
3300009088|Ga0099830_11493216All Organisms → cellular organisms → Bacteria → PVC group563Open in IMG/M
3300009089|Ga0099828_12007029All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp.506Open in IMG/M
3300009090|Ga0099827_10546558All Organisms → cellular organisms → Bacteria → PVC group997Open in IMG/M
3300009100|Ga0075418_10273361All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300009137|Ga0066709_103548145All Organisms → cellular organisms → Bacteria → PVC group566Open in IMG/M
3300009147|Ga0114129_13283117All Organisms → cellular organisms → Bacteria → PVC group524Open in IMG/M
3300009148|Ga0105243_10661014All Organisms → cellular organisms → Bacteria → PVC group1014Open in IMG/M
3300009148|Ga0105243_11711118All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium658Open in IMG/M
3300009156|Ga0111538_10575838All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300010042|Ga0126314_10746425All Organisms → cellular organisms → Bacteria → PVC group719Open in IMG/M
3300010304|Ga0134088_10412481All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp.659Open in IMG/M
3300010322|Ga0134084_10329141All Organisms → cellular organisms → Bacteria → PVC group576Open in IMG/M
3300010326|Ga0134065_10466485All Organisms → cellular organisms → Bacteria → PVC group520Open in IMG/M
3300010360|Ga0126372_12718788All Organisms → cellular organisms → Bacteria → PVC group547Open in IMG/M
3300010397|Ga0134124_13153878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae505Open in IMG/M
3300011271|Ga0137393_11765694All Organisms → cellular organisms → Bacteria → PVC group507Open in IMG/M
3300011443|Ga0137457_1277411All Organisms → cellular organisms → Bacteria → PVC group573Open in IMG/M
3300012039|Ga0137421_1254819All Organisms → cellular organisms → Bacteria → PVC group508Open in IMG/M
3300012200|Ga0137382_11245442All Organisms → cellular organisms → Bacteria → PVC group527Open in IMG/M
3300012210|Ga0137378_11190116All Organisms → cellular organisms → Bacteria → PVC group678Open in IMG/M
3300012350|Ga0137372_10533495All Organisms → cellular organisms → Bacteria → PVC group869Open in IMG/M
3300012353|Ga0137367_10784516All Organisms → cellular organisms → Bacteria → PVC group662Open in IMG/M
3300012360|Ga0137375_10072623All Organisms → cellular organisms → Bacteria3625Open in IMG/M
3300012360|Ga0137375_11215768All Organisms → cellular organisms → Bacteria → PVC group576Open in IMG/M
3300012363|Ga0137390_10830501All Organisms → cellular organisms → Bacteria → PVC group881Open in IMG/M
3300012532|Ga0137373_10186306All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1721Open in IMG/M
3300012917|Ga0137395_10138602All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1656Open in IMG/M
3300012929|Ga0137404_10974698All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia775Open in IMG/M
3300012975|Ga0134110_10014526All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3006Open in IMG/M
3300013297|Ga0157378_13294039All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp.502Open in IMG/M
3300014488|Ga0182001_10437104All Organisms → cellular organisms → Bacteria → PVC group582Open in IMG/M
3300016371|Ga0182034_10291045All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D151305Open in IMG/M
3300016422|Ga0182039_10369800All Organisms → cellular organisms → Bacteria → PVC group1209Open in IMG/M
3300016445|Ga0182038_11471547All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15611Open in IMG/M
3300017787|Ga0183260_10861149All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes564Open in IMG/M
3300018433|Ga0066667_10440411All Organisms → cellular organisms → Bacteria → PVC group1062Open in IMG/M
3300018433|Ga0066667_10789423All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia806Open in IMG/M
3300018468|Ga0066662_11515612All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia698Open in IMG/M
3300018468|Ga0066662_11586148All Organisms → cellular organisms → Bacteria → PVC group683Open in IMG/M
3300018481|Ga0190271_13038190All Organisms → cellular organisms → Bacteria → PVC group563Open in IMG/M
3300020018|Ga0193721_1136861All Organisms → cellular organisms → Bacteria → PVC group602Open in IMG/M
3300021171|Ga0210405_10505361All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp.947Open in IMG/M
3300022756|Ga0222622_11277099All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium540Open in IMG/M
3300024330|Ga0137417_1385654All Organisms → cellular organisms → Bacteria → PVC group1506Open in IMG/M
3300025936|Ga0207670_10391749All Organisms → cellular organisms → Bacteria → PVC group1109Open in IMG/M
3300025960|Ga0207651_11807786All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae550Open in IMG/M
3300025961|Ga0207712_11529075All Organisms → cellular organisms → Bacteria → PVC group598Open in IMG/M
3300026089|Ga0207648_11673496All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium598Open in IMG/M
3300026095|Ga0207676_10439254All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300026121|Ga0207683_11150836All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia719Open in IMG/M
3300026277|Ga0209350_1130018All Organisms → cellular organisms → Bacteria → PVC group567Open in IMG/M
3300026550|Ga0209474_10368587All Organisms → cellular organisms → Bacteria → PVC group783Open in IMG/M
3300027513|Ga0208685_1104613All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp.608Open in IMG/M
3300027824|Ga0209040_10537587All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia511Open in IMG/M
3300027886|Ga0209486_11315728All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia501Open in IMG/M
3300027909|Ga0209382_11845760All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15586Open in IMG/M
3300031679|Ga0318561_10818199All Organisms → cellular organisms → Bacteria → PVC group512Open in IMG/M
3300031680|Ga0318574_10895478All Organisms → cellular organisms → Bacteria → PVC group520Open in IMG/M
3300031779|Ga0318566_10561952All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15557Open in IMG/M
3300031852|Ga0307410_10749755All Organisms → cellular organisms → Bacteria → PVC group827Open in IMG/M
3300031910|Ga0306923_12344379All Organisms → cellular organisms → Bacteria → PVC group531Open in IMG/M
3300031911|Ga0307412_10589539All Organisms → cellular organisms → Bacteria → PVC group940Open in IMG/M
3300031954|Ga0306926_12951000All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15509Open in IMG/M
3300031962|Ga0307479_11404020All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15657Open in IMG/M
3300034268|Ga0372943_0906504All Organisms → cellular organisms → Bacteria → PVC group586Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil14.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.55%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.82%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.91%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10044267913300000956SoilEEKRFDEIGWAKDIREARRLAAQHNRPVFLFTHDGRMNIGRC*
Ga0062384_10070749623300004082Bog Forest SoilRFDEIGWAKDLPAAEKLGKANGRPVFLFTHNGRMETGRC*
Ga0062589_10045428513300004156SoilEKRFDEIGWAKDIRQARQLSADSNRPVFLFTHDGRMNIGRC*
Ga0063356_10196299113300004463Arabidopsis Thaliana RhizosphereGEKRFDEIGWARDIRSAIKLAGEHQRPVFLFTHDGRMNIGRC*
Ga0062592_10032385923300004480SoilDPSAWVDAKVAACSPKPEERRFDQTGWLTEIRSALALAKAHNRPVFLFTHDGRMGLGRC*
Ga0066673_1019042133300005175SoilASAKERRIDEIGWAKDIREAERLARENNRPVFLFTHDGRINTGRC*
Ga0066684_1024875113300005179SoilPTAKERRIDEIGWAGGIREAERLAKQNNRPVFLFTHDGRINTGRC*
Ga0066676_1072441413300005186SoilERRIDEIGWASDIRQAERLAAENKRPVFLFTHDGHINTGRC*
Ga0065707_1100843613300005295Switchgrass RhizosphereVQELQPTAKDRRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC*
Ga0066388_10434022623300005332Tropical Forest SoilRFDEIGWVKSVLEGEQLAKQHNRPLFWFTHDGKMSEGRC*
Ga0066388_10531026413300005332Tropical Forest SoilEERQPPAADKRFDEIGWAHDIRTALPLAKKHDRPLFLFTHDGRINTGRC*
Ga0066388_10677231623300005332Tropical Forest SoilDERRFDDIGWVKDIREALKLAKEHDRPVFLFTHDGRINIGRC*
Ga0066388_10784918513300005332Tropical Forest SoilRFDQIGWAKDIRTAEELAKKHGRPVFLFTHDGRMGVGRC*
Ga0068869_10109938913300005334Miscanthus RhizosphereTELDPKPEEKRFDEIGWAPNILTAENSAKSSRRPVFLFTHDGRINTGRC*
Ga0068868_10229876113300005338Miscanthus RhizosphereARERRIDEIGWASDIRQARRLAGENNRPVFLFTHDGHINTGRC*
Ga0070681_1071281813300005458Corn RhizosphereRDAQPTRAEKRFDEIGWAKSILEAERLAKQFKRPVFLFTHDGKMETGRC*
Ga0068867_10187101023300005459Miscanthus RhizosphereCSPKPEERRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC*
Ga0070698_10103514223300005471Corn, Switchgrass And Miscanthus RhizosphereAKERRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRMNIGRC*
Ga0070695_10071394113300005545Corn, Switchgrass And Miscanthus RhizosphereAVRKRIAEIEPKPEEKRFDEIGWAKDIREARRLAAQHNRPVFLFTHDGRMNIGRC*
Ga0070704_10023403133300005549Corn, Switchgrass And Miscanthus RhizosphereAKERRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC*
Ga0066698_1081645623300005558SoilIDEIGWASDIRQAERLAGEHGRPVFLFTHDGHINTGRC*
Ga0066698_1100039213300005558SoilGWAEDIRDALRLAQANQRPVFLFTHDGRMNIGRC*
Ga0066670_1069928513300005560SoilERRIDEIGWASDIRHAERLAGENSRPVFLFTHDGHINTGRC*
Ga0068856_10205851013300005614Corn RhizosphereKRVTEWQPKASERRFDEIGWSKDILSARRLAQSSQRPVFIFTMDGRINLGRC*
Ga0068864_10149220723300005618Switchgrass RhizosphereRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC*
Ga0066903_10345650723300005764Tropical Forest SoilEEKRFDEIGWAHNVLDAEKLAAEHKRPIFLFTHDGKMNCGRC*
Ga0066903_10725976513300005764Tropical Forest SoilADRPFDEIGWAKDIREAERLARDNDRPVFLFTHDGHMAVGRC*
Ga0066903_10870916723300005764Tropical Forest SoilDKRFDEIGWAHDIRTALALAKEHDRPVFLFTHDGQMNLGRC*
Ga0068858_10074855623300005842Switchgrass RhizosphereELQPTAKERRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC*
Ga0075428_10206445623300006844Populus RhizosphereEEKRFDEIGWAKDIREALRLAKQHNRPVFLFTHDGRMNIGRC*
Ga0075421_10173707213300006845Populus RhizosphereDDIGWAPDLCTALKAGKVHQRPVFLFTHDGRMQFGRC*
Ga0075431_10194270113300006847Populus RhizosphereVGWAADIRDAERLAKEHQRPVFLFTHDGRMNIGRC*
Ga0075425_10212827923300006854Populus RhizosphereTREERRLDEIGWARNIREAEQLGREHTRPVFLFTHDGRIATGRC*
Ga0079217_1169736423300006876Agricultural SoilDVASWVDQKVAACAPKPEERRFDQTGWLTDIRSALALAKQHNRPVFLFTHDGRMGLGRC*
Ga0068865_10113210023300006881Miscanthus RhizosphereNERRMDDIGWARDIREALRLAKEHKRPVFLFTHDGRMAAGRC*
Ga0099794_1075123713300007265Vadose Zone SoilLQPTAKEKRFDEIGWASDIRSAEKLAKDNNRPVFLFTHDGRMNIGRC*
Ga0066710_10099471013300009012Grasslands SoilAKEKRFDEIGWAEDIRDALRLGKANQRPVFLFTHDGRMNIGRC
Ga0066710_10195275123300009012Grasslands SoilQELEPTAKERRLDEIGWAGSIREAERLAKQNNRPVFLFTHDGRINTGRC
Ga0099830_1149321613300009088Vadose Zone SoilRRFDEIGWAKDIRTAEKLAKDNNRPVFLFTHDGHMDVGRC*
Ga0099828_1200702933300009089Vadose Zone SoilRFDEIGWAKDIRTALRLARAQRRPVFLSTMDGRINIGRC*
Ga0099827_1054655813300009090Vadose Zone SoilIGWASDIRSAEKLAQENNRPVFLFTHDGRMNIGRC*
Ga0075418_1027336113300009100Populus RhizosphereKPEEKRFDEIGWAKDIREARRLAAQHNRPVFLFTHDGRMNIGRC*
Ga0066709_10354814523300009137Grasslands SoilPLRAERRFDVIAWVGGIREARRLAKTHARPVFLFTHDGHMDVGRC*
Ga0114129_1328311723300009147Populus RhizosphereAFDRIGWAPDVRTAERLSRESKRPVFLFTHDGRINTGRC*
Ga0105243_1066101413300009148Miscanthus RhizosphereDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC*
Ga0105243_1171111813300009148Miscanthus RhizosphereGWLTEIRSALALAKAHNRPVFLFTHDGRMGLGRC*
Ga0111538_1057583813300009156Populus RhizosphereQRVAELRPRTEEKRFDEIGWAKDIRDALRLAKQHNRPVFLFTHDGRMNIGRC*
Ga0126308_1083769923300010040Serpentine SoilVKQWVDQKVADCEPKPEERRFDQTGWAPDIRAALKLAKEHHRPVFLFTHDGHMAVGRC*
Ga0126314_1074642523300010042Serpentine SoilAACAPKPEERRFDQTGWLTDIRSALELAKQNNRPVFLFTHDGRMGLGRC*
Ga0134088_1037307413300010304Grasslands SoilLTAWVDQRIKECEPKPEERRFDEIGWVQSIREAERLAKQHERPVFLFTHDGRMGIGRC*
Ga0134088_1041248113300010304Grasslands SoilARVRALQPTGAEKRFDEIGWARDIRDAERLAKEHHRPVFLFTHDGRINLGRC*
Ga0134084_1032914123300010322Grasslands SoilQALQPTAREKRFDEIGWASDIRSAEKLARENNRPVFLFTHDGRMNIGRC*
Ga0134065_1046648523300010326Grasslands SoilVQELEPTAKERRLDEIGWAGSIREAERLAKQNNRPVFLFTHDGRINTGRC*
Ga0126372_1271878813300010360Tropical Forest SoilALQPTAEEKRLDEIGWAKNIVEAEKLARGSNRPVFLFAHDGNIATGRC*
Ga0134124_1315387813300010397Terrestrial SoilFDQVGWAKDILDAERLAKLHNRPIFLFTHDGRVNWGRC*
Ga0137393_1176569413300011271Vadose Zone SoilKRVRDWQPTADDRRFDEIGWAKDIREAEKLAKENNRPVFLFTHDGRMNIGRC*
Ga0137457_127741123300011443SoilPEEKRFDEIGWAKDIRDAKELAKQHQRPVFLFTHDGRMNIGRC*
Ga0137421_125481913300012039SoilLQPRPEEKRFDEIGWAKDIRDAKELAKQHQRPIFLFTHDGRMNIGRC*
Ga0137382_1124544213300012200Vadose Zone SoilPRERRIDEIGWASDIRQAERLAGEHSRPVFLFTHDGHINTGRC*
Ga0137378_1119011613300012210Vadose Zone SoilGWASDIRQAERLARENSRPVFLFTHDGHINTGRC*
Ga0150985_10849656113300012212Avena Fatua RhizosphereVKPWVDQKVADCEPKPEERRFDETGWLTAIGPALKLAKEHHRPVFLFTHDGHMAVGRC*
Ga0150985_11056102833300012212Avena Fatua RhizosphereGWVDKKVAECSPKPEERRFDQTGWLTDIRSALELAKRHNRPVFLFTHDGRMGLGRC*
Ga0137372_1053349513300012350Vadose Zone SoilRFDEIGWASDILEARRLAKEHKRPIFLFTHDGHMAVGRC*
Ga0137367_1078451613300012353Vadose Zone SoilAARERRIDEIGWASDIRQAERLAGEHSRPVFLFTHDGHINTGRC*
Ga0137375_1007262363300012360Vadose Zone SoilFDEIGWAKDIRTAERLARDNNRPVFLFTHDGRMNIGRC*
Ga0137375_1121576823300012360Vadose Zone SoilAARERRIDEIGWASDIRQAERLAGENSRPVFLFTHDGHINTGRC*
Ga0137390_1083050123300012363Vadose Zone SoilLQPTANEKRLDEIGWAKDIRSAEKLAQEHNRPVFLFTHDGRMNIGRC*
Ga0150984_10647365313300012469Avena Fatua RhizosphereASAPADGEVAGWVDKKVAECSPKPEERRFDQTGWLTDIRSALELAKRHNRPVFLFTHDGRMGLGRC*
Ga0137373_1018630613300012532Vadose Zone SoilRERRIDEIGWASDIRQAERLAGEHNRPVFLFTHDGHINTGRC*
Ga0137395_1013860233300012917Vadose Zone SoilDEIGWASDIRQAERLARENSRPVFLFTHDGHINTGRC*
Ga0137404_1097469813300012929Vadose Zone SoilEKRFDEIGWAKNILDAERLAKQYGRPVFLFTHDGKMETGRC*
Ga0134110_1001452613300012975Grasslands SoilLEPTVKERRIDEIGWAGGIREAERLAKQNNRPVFLFTHDGRINTGRC*
Ga0157378_1329403913300013297Miscanthus RhizospherePKASERRFDEIGWAKDIRTAKQLAQGSQRPVFVFTMDGRINLGRC*
Ga0182001_1043710423300014488SoilQPTEREKRWETIGWAKDIRDALKLAKEHNRPAFLFTLDGRMNVGRC*
Ga0182008_1070409313300014497RhizosphereAAWVDQKVADCSPRPEERRFDQTGWLTDIRSALALANQHDRPVFLFTHDGRMGLGRC*
Ga0182034_1029104513300016371SoilAADKRFDEIGWAHDLRTALALAKEHDRPVFLFTHDGRINTGRC
Ga0182039_1036980033300016422SoilRFDDIGWVDTIGEALQLGKKHQRPVFLFTHDGRIAIGRC
Ga0182038_1147154713300016445SoilRFDEIGWAHDIRTALALAKKHDRPVFLFTHDGRINTGRC
Ga0183260_1086114913300017787Polar Desert SandAAERTFDQIAWSTDILTALERAKKNDRPIFLFTHDGRMALGRC
Ga0066667_1044041123300018433Grasslands SoilLGWVEKRVADLQASAKEGRIDEIGWAKNIREAERVARENNRPVFLFTHDGRINTGRC
Ga0066667_1078942323300018433Grasslands SoilSEKRFDEIGWAKNILDAERLAKQYGRPVFLFTHDGKMETGRC
Ga0066662_1151561213300018468Grasslands SoilASRVNELQPTPQERKIDRIGWARTILGAEKLAREHGRPVFLFTHDGRINTGRC
Ga0066662_1158614813300018468Grasslands SoilRRFDEIGWVGDIFEARRLARLHNRPVFLFTHDGHMAVGRC
Ga0190271_1303819013300018481SoilEIGWASDIRDALRLAKENRRPVFLFTHDGRMAAGRC
Ga0193721_113686113300020018SoilRRLDEIGWAKDIREAERLAKENRRPVFLFTHDGRLNIGRC
Ga0210405_1050536123300021171SoilTAKEKRFDEIGWAKDIREAEKLAKENKRPVFLFTHDGRMNIGRC
Ga0222622_1127709913300022756Groundwater SedimentPTDAERRIDQVGWATSLLEAEKLAKQHNRPVFLFTHDGRIGNGRC
Ga0137417_138565413300024330Vadose Zone SoilMKIGWAKDIRSAEKLAQENNRPVFLFTHDGRMNIGRC
Ga0207657_1149044923300025919Corn RhizospherePPSGDPSSYVDAKVAACSPKPEERRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC
Ga0207670_1039174923300025936Switchgrass RhizosphereQQLQPQAKEKRLDDIGWAKDIRAAIKLAGEHQRPVFLFTHDGRMNIGRC
Ga0207651_1180778623300025960Switchgrass RhizosphereAQPTRTERKFDEVGWAKDIRDAERLAKLHQRPIFLFTHDGRVNLGRC
Ga0207712_1152907513300025961Switchgrass RhizosphereAAAAKEKRLDEIGWAKDIRAAIKLAGEHQRPVFLFTHDGRMNIGRC
Ga0207648_1167349613300026089Miscanthus RhizosphereEERRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC
Ga0207676_1043925413300026095Switchgrass RhizosphereWQPNAAEKRWESIGWAKDIRRALRLAQQHQRPVFLFTLDGRMNLGRC
Ga0207683_1115083613300026121Miscanthus RhizosphereLQPRTEEKRFDEIGWAKDIRDALRLAKQHHRPVFLFTHDGRMNIGRC
Ga0209350_113001823300026277Grasslands SoilRIDEIGWAGSIREAERLAKQNKRPVFLFTHDGRINTGRC
Ga0209474_1036858723300026550SoilERRCDEIGWAKDIREAERLAKAHNRPVFLFTHDGRMAVGRC
Ga0208685_110461323300027513SoilRFDEIGWAKDIREALRLAKQHNRPVFLFTHDGRMNIGRC
Ga0209040_1053758713300027824Bog Forest SoilDEIGWASDILEARRLAKQHNRPVFLFTHDGHMAVGRC
Ga0209486_1131572813300027886Agricultural SoilAPTADERRFDEIGWARDIREGRRLSRESGRPLFLFTHDGRMAVGRC
Ga0209382_1184576023300027909Populus RhizosphereRIDEIGWAADIREALRLSRESRRPVFLFTHDGRMGVGRC
Ga0318561_1081819913300031679SoilEKRFDEVGWATEILAGRELAKKNNRPVFLFTHDGHMAVGRC
Ga0318574_1089547823300031680SoilDDIAWVGDIREALKLARQHGRPVFLFTHDGRMNIGRC
Ga0318566_1056195223300031779SoilSSKRRSAPVGWVHTVVEAQRLAKEHNRPVFLFTHDGRMNLGRC
Ga0307410_1074975523300031852RhizosphereRFDQTGWLTDIRSALKLAKEHDRPVFLFTHDGHMDVGRC
Ga0306923_1234437923300031910SoilSEKRFDEVGWATEILAGRELAKKNNRPVFLFTHDGHMAVGRC
Ga0307412_1058953913300031911RhizosphereDCSPKPEERRFDRTGWLTDIRSALELANRHNRPVFLFTHDGRMGLGRC
Ga0306926_1295100023300031954SoilQPPATDKRFDEIGWAHDIRTALALAKEHDRPVFLFTHDGRINTGRC
Ga0307479_1140402013300031962Hardwood Forest SoilEDRKFDEIGWSNSIVDAEKLARQNNRPVFLFTQNGRIEIGRT
Ga0372943_0906504_1_1443300034268SoilWQPTAEERRFDEIGWAGGLRDAIRLAKAHGRPVFLFTHDGHMAIGRC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.