NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086029

Metagenome / Metatranscriptome Family F086029

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086029
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 41 residues
Representative Sequence MAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP
Number of Associated Samples 91
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.30 %
% of genes from short scaffolds (< 2000 bps) 84.68 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(31.532 % of family members)
Environment Ontology (ENVO) Unclassified
(32.432 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.351 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.41%    β-sheet: 16.18%    Coil/Unstructured: 79.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF13419HAD_2 57.66
PF13620CarboxypepD_reg 16.22
PF00708Acylphosphatase 1.80
PF00156Pribosyltran 1.80
PF02805Ada_Zn_binding 0.90
PF00588SpoU_methylase 0.90
PF01663Phosphodiest 0.90
PF01022HTH_5 0.90
PF16864Dimerisation2 0.90
PF00999Na_H_Exchanger 0.90
PF00892EamA 0.90
PF16702DUF5063 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.90
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.90
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.90
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.90
COG2169Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domainsReplication, recombination and repair [L] 0.90
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.90
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.90
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.90

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_101050515All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300002562|JGI25382J37095_10032814All Organisms → cellular organisms → Bacteria → Acidobacteria2035Open in IMG/M
3300004121|Ga0058882_1723292All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005177|Ga0066690_10956459All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300005552|Ga0066701_10387407All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005553|Ga0066695_10612077All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005560|Ga0066670_10038145All Organisms → cellular organisms → Bacteria2407Open in IMG/M
3300005602|Ga0070762_10460118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria829Open in IMG/M
3300005952|Ga0080026_10268870All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006050|Ga0075028_100475683All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300006174|Ga0075014_100350003All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300006796|Ga0066665_11512158All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006893|Ga0073928_10007502All Organisms → cellular organisms → Bacteria → Acidobacteria14087Open in IMG/M
3300009012|Ga0066710_100149639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3244Open in IMG/M
3300009038|Ga0099829_10413957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1115Open in IMG/M
3300009038|Ga0099829_11139482All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300009090|Ga0099827_10460821All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300009618|Ga0116127_1050815All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300010337|Ga0134062_10342046All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010343|Ga0074044_10134931All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300010358|Ga0126370_12269036All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010360|Ga0126372_12712923All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300010400|Ga0134122_10009913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7075Open in IMG/M
3300011120|Ga0150983_10563646All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300011269|Ga0137392_11317604All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012169|Ga0153990_1067076All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300012189|Ga0137388_10667245All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300012200|Ga0137382_10742898All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012203|Ga0137399_10496022All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300012203|Ga0137399_11127963All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300012203|Ga0137399_11698695All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300012205|Ga0137362_10685774All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300012205|Ga0137362_11616800All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300012207|Ga0137381_10052058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3385Open in IMG/M
3300012207|Ga0137381_10618221All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300012208|Ga0137376_10493712All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300012209|Ga0137379_10260019All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300012211|Ga0137377_11279799All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012351|Ga0137386_10280074All Organisms → cellular organisms → Bacteria1200Open in IMG/M
3300012361|Ga0137360_10022551All Organisms → cellular organisms → Bacteria → Acidobacteria4231Open in IMG/M
3300012361|Ga0137360_11371984All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300012917|Ga0137395_10638955All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300012927|Ga0137416_11686880All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300012927|Ga0137416_11699429All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012927|Ga0137416_11835968All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300012927|Ga0137416_12195376All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012929|Ga0137404_10478521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1108Open in IMG/M
3300012930|Ga0137407_12019493All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300012957|Ga0164303_11212542All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300013307|Ga0157372_12042895All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300014150|Ga0134081_10026006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1672Open in IMG/M
3300014157|Ga0134078_10072683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1237Open in IMG/M
3300015054|Ga0137420_1318756All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300015054|Ga0137420_1366032All Organisms → cellular organisms → Bacteria → Acidobacteria2255Open in IMG/M
3300015054|Ga0137420_1461460All Organisms → cellular organisms → Bacteria6845Open in IMG/M
3300015264|Ga0137403_10769377All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300015359|Ga0134085_10474484All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300016270|Ga0182036_10846930All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300017928|Ga0187806_1033135All Organisms → cellular organisms → Bacteria → Acidobacteria1534Open in IMG/M
3300017995|Ga0187816_10035749All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2035Open in IMG/M
3300018085|Ga0187772_10458247All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300020021|Ga0193726_1296881All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300020199|Ga0179592_10020825All Organisms → cellular organisms → Bacteria → Acidobacteria2917Open in IMG/M
3300020579|Ga0210407_11333990All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300020579|Ga0210407_11483327All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300020580|Ga0210403_11338252All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300020583|Ga0210401_10043141All Organisms → cellular organisms → Bacteria4269Open in IMG/M
3300021168|Ga0210406_10670377All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300021170|Ga0210400_10919821All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300021170|Ga0210400_11350271All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300021171|Ga0210405_11111464All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300021178|Ga0210408_10485723All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300021178|Ga0210408_10598093All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300021181|Ga0210388_10229171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1629Open in IMG/M
3300021181|Ga0210388_10907445All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300021402|Ga0210385_10490667All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300021407|Ga0210383_11470925All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300021407|Ga0210383_11574743All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300021432|Ga0210384_11639730All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021475|Ga0210392_11282783All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021478|Ga0210402_10015494All Organisms → cellular organisms → Bacteria6523Open in IMG/M
3300021478|Ga0210402_11683003All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium561Open in IMG/M
3300021559|Ga0210409_10044941All Organisms → cellular organisms → Bacteria4174Open in IMG/M
3300021559|Ga0210409_10667784All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300021560|Ga0126371_13530501All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300022557|Ga0212123_10940612All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025414|Ga0208935_1015715All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300025906|Ga0207699_10523173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300026328|Ga0209802_1120019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1156Open in IMG/M
3300026335|Ga0209804_1088792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1437Open in IMG/M
3300026557|Ga0179587_10027007All Organisms → cellular organisms → Bacteria → Acidobacteria3151Open in IMG/M
3300027512|Ga0209179_1128086All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300027674|Ga0209118_1044717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1323Open in IMG/M
3300027829|Ga0209773_10156072All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300027862|Ga0209701_10706750All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300027875|Ga0209283_10887086All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027889|Ga0209380_10391472All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300027915|Ga0209069_10524677All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300028906|Ga0308309_10242639All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300028906|Ga0308309_11564711All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300029636|Ga0222749_10421948All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300029636|Ga0222749_10680818All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031708|Ga0310686_101064600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3228Open in IMG/M
3300031718|Ga0307474_10831804All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300031720|Ga0307469_11073447All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031835|Ga0318517_10237697All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300031879|Ga0306919_10565758All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300031962|Ga0307479_11740060All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300032001|Ga0306922_10162396All Organisms → cellular organisms → Bacteria2392Open in IMG/M
3300032180|Ga0307471_101221559All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300034125|Ga0370484_0227677All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium514Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil31.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.60%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.80%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.90%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.90%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012169Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaGHost-AssociatedOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10105051513300002245Forest SoilMAHVRRAETAAMPGWYGIAAAFDDVQFDRDDRLPSRFLKP*
JGI25382J37095_1003281413300002562Grasslands SoilTIATVRRIELAATPGWFGVAASFDDMEFGRDDMIPSRFLDE*
Ga0058882_172329213300004121Forest SoilVSTARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP*
Ga0066690_1095645923300005177SoilKAHVQRYEPASMRGWYGVAASFDDVQFDRDDRIPTRFLKP*
Ga0066701_1038740723300005552SoilRVCRVEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFLKP*
Ga0066695_1061207723300005553SoilRTETAAMPGWHGIAAIFDDVQFDRDDRIPSRYLKS*
Ga0066670_1003814513300005560SoilMGMGSVVMTTLARVCRIEAAAMPGWHGLAACFDDVQFDHDDDMPSRFLKP*
Ga0070762_1046011813300005602SoilIVTTARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP*
Ga0080026_1026887013300005952Permafrost SoilAHVRRSDPAAMPGWYGIAATFDDVQFDRDDCVPTRFLSV*
Ga0075028_10047568323300006050WatershedsGNVVMATMAHVCRTEPAAMPGWYGIAAAFDDVQFDRDDHMPSRFLKP*
Ga0075014_10035000313300006174WatershedsLGNVVVATMAHVCRTESAAMPGWYGVAAAFDDVQFDRDDHMPSRFLKP*
Ga0066665_1151215813300006796SoilNVVVATMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0073928_10007502133300006893Iron-Sulfur Acid SpringVRRLEPAATPGWYGVAVLFDDMSFDRDDRVPSRFLSL*
Ga0066710_10014963963300009012Grasslands SoilCRAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP
Ga0099829_1041395733300009038Vadose Zone SoilAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLVVS*
Ga0099829_1113948213300009038Vadose Zone SoilNVVAATMSRVCRTEPAAVAGWHGIAAAFDDVQFDRDDRIPSRYLKP*
Ga0099827_1046082133300009090Vadose Zone SoilVCRIEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFLKP*
Ga0116127_105081513300009618PeatlandVEAAATPGWHGIAASFDDVEFDRDDLVPSRFLNW*
Ga0134062_1034204623300010337Grasslands SoilGRGSVLMTTMAHVCRTEAAAMPGWYGFAACFDDVEFDHDDDLPSRFLRP*
Ga0074044_1013493113300010343Bog Forest SoilMGHGSVVIVTTARVQRCGPAATPGWYGIAASYDDVQFDRDDGLPSHFQRP*
Ga0126370_1226903613300010358Tropical Forest SoilTLAHVCRTEAAAMPGWYGLAACFDDVQFDHDDDLPSRFLKR*
Ga0126372_1271292323300010360Tropical Forest SoilRRIEPAAMPGWYGIAVAFTDVQFDRDDGIPARFL*
Ga0134122_1000991373300010400Terrestrial SoilARVQRIETAAMPGWYGVAATFDELAFDRDDRVPSRFLKP*
Ga0150983_1056364613300011120Forest SoilGNVVVATMAHVRRAETAAMPGWYGIAAAFDDVQFDRDDHIPSRFLKP*
Ga0137392_1131760423300011269Vadose Zone SoilTMAHVCRAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0153990_106707613300012169Attine Ant Fungus GardensTEPAATPGWYGIAASFDDVQFDRDDRVPARFLNP*
Ga0137388_1066724523300012189Vadose Zone SoilHVRRVEPAAMPNWYGIAASFDDVQFDRDDGIPIRFL*
Ga0137382_1074289813300012200Vadose Zone SoilMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0137399_1049602223300012203Vadose Zone SoilCRAETAAMPGWYGIAAAFDDVQFDRDDRVPSRFLKP*
Ga0137399_1112796313300012203Vadose Zone SoilVVAATMARVCRTEAAAVPGWHGIAAAFDEVQFDRDDCIPSRYLKP*
Ga0137399_1169869513300012203Vadose Zone SoilHEPASMPGWYGIAASFDDVQFDRDDRVPSRFLNP*
Ga0137362_1068577413300012205Vadose Zone SoilRAEPAATPNWYGIAASFDDMEFDRDDGVPSRFLGS*
Ga0137362_1161680013300012205Vadose Zone SoilAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0137381_1005205813300012207Vadose Zone SoilRTEAAAMRGWYGLAASFDDVQFDHDDDVPSRFLKP*
Ga0137381_1061822123300012207Vadose Zone SoilRIEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFMKP*
Ga0137376_1049371223300012208Vadose Zone SoilGNVVVATMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0137379_1026001913300012209Vadose Zone SoilTMARVCRVEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFLKP*
Ga0137377_1127979923300012211Vadose Zone SoilVCRIEAAAMPSWFGIAATFDDVQFDRDDGIPSRFLKP*
Ga0137386_1028007413300012351Vadose Zone SoilTMARVCRIEVAAMPGWYGIAAFFEDVQFDRDDGVPSRFMKP*
Ga0137360_1002255113300012361Vadose Zone SoilVMMTMAHVQRAEPAATPNWYGIAASFDDMEFDRDDGVPSRFLGS*
Ga0137360_1137198423300012361Vadose Zone SoilATTARVRRLEPAAMPGWYGVAALFDDMSFDRDDRVPSRFLGL*
Ga0137395_1063895513300012917Vadose Zone SoilNVVMATMANVVRAEAAAMPGWHGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0137416_1168688023300012927Vadose Zone SoilCRAEAAAMPGWYGIAAAFDDVQFDRDDHIPSRFLKP*
Ga0137416_1169942913300012927Vadose Zone SoilGNVVLVSMARVRRTEPSAVPGWFGVAAAFEDVQFDRDDGLPSRFQKL*
Ga0137416_1183596823300012927Vadose Zone SoilATMAHVCRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0137416_1219537623300012927Vadose Zone SoilHVCRAETAAMPGWYGIATSFDDVQFDRDDRLPSRFLKP*
Ga0137404_1047852113300012929Vadose Zone SoilNVVVATMAHVCRREPAATPGWFGIAAAFDDVQFDRDDRIPSRYLKP*
Ga0137407_1201949313300012930Vadose Zone SoilRTESAAMPGWFGVAAAFDDVEFDRDDGLPCRFQKP*
Ga0164303_1121254223300012957SoilVGRTELAAVPGWFGAAAAFDDVQFDRDDGLPSRFQKP*
Ga0157372_1204289523300013307Corn RhizosphereRIETAAMPGWYGVAATFDELAFDRDDRVPSRFLKP*
Ga0134081_1002600613300014150Grasslands SoilNVVVATMARVCRTETVAMPGWHGIAAAFDDVQFDRDDCIPSRYLKP*
Ga0134078_1007268313300014157Grasslands SoilGNVVAVTMARVRRTETAAMPGWHGIAAIFDDVQFDRDDRIPSRYLKS*
Ga0137420_131875613300015054Vadose Zone SoilGLGNVVVATMAHVRRAETAAVPGWFGIAAAFDDVQFDRDDRIPSRFLKP*
Ga0137420_136603213300015054Vadose Zone SoilMATMAHVCRAETAAMPGWHGIAAAFKEVLQFDRDDRIPSRFLKP*
Ga0137420_146146023300015054Vadose Zone SoilMAHVCRIETAAMPGWHGIAAAFDDVQFDRDDRVPSRYLKP*
Ga0137403_1076937723300015264Vadose Zone SoilATMAHVCRAETAAMPGWHGIAAAFKEVQFDRDDRIPSRFLKP*
Ga0134085_1047448413300015359Grasslands SoilTVRRIEPAATPGWFGVAASFDDMEFGRDDVIPSRFLDA*
Ga0182036_1084693023300016270SoilMGRGSVVMTTMAHVCRAEAAATPGWYELAACFDDVQFDHDDDLPSRFLKP
Ga0187806_103313533300017928Freshwater SedimentMVTLAQVCRTEKADMPGWFGVAASFNDVQFDRDDSIPSRYLKP
Ga0187816_1003574933300017995Freshwater SedimentLAQVCRVEKADMPGWFGVAASFNDVQFDRDDSIPSRYLKP
Ga0187772_1045824723300018085Tropical PeatlandVCRIEAANMPGWYGIAAKFEDFGFDRDDRIPEPITVD
Ga0193726_129688113300020021SoilRVERAAMPGWYGVAASFDDVEFDRDDSVPTRFECF
Ga0179592_1002082513300020199Vadose Zone SoilTTMARVCRTETAAMPGWHGIAAAFDDVQFDRDDRIPSRYLKP
Ga0210407_1133399013300020579SoilSTARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP
Ga0210407_1148332723300020579SoilRAEAAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP
Ga0210403_1133825213300020580SoilHVQRYEPASMPGWYGIAAAFDDVQFDRDDRVPTRFLKP
Ga0210401_1004314113300020583SoilKAHVQRYEPASMPGWYGIAAAFDDVQFDRDDRVPTRFLKP
Ga0210406_1067037713300021168SoilARVQRIEPAAMPGWYGVAASFDDVQFDRDDGVPSRFLRP
Ga0210400_1091982123300021170SoilSRAHVQRCETAAMPGWYGIATSFDDVQFDRDDRVPARFLKP
Ga0210400_1135027123300021170SoilNVVLATRAHVQRCDPAATPGWHGIAALFDDVQFDRDDRVPTRFLKP
Ga0210405_1111146423300021171SoilTRAHVQRSDPAATPGWHGIAASFDDVQFDRDDRVPSRFLKP
Ga0210408_1048572313300021178SoilARVQRLEPAAVPRWYGVAALFDDMCFDRDDRVPSRFLNL
Ga0210408_1059809323300021178SoilLATRAHVQRCDPAATPGWHGIAALFDDVQFDRDDRVPTRFLKP
Ga0210388_1022917113300021181SoilTARVQRIEPAAMPGWYGVAAAFDDVKFDRDDGVPSRFLRP
Ga0210388_1090744513300021181SoilRVQRIEAAAMPGWYGVAAAFDDVHFDRDDGLPSRFQRP
Ga0210385_1049066713300021402SoilQRLEPAAMPGWYGVAALFDDMSFDRDDRVPARFLKL
Ga0210383_1147092513300021407SoilRVRRLEPAAMPGWYGVAALFDDMSFDRDDRVPARFLKL
Ga0210383_1157474313300021407SoilVVATTACVRRLEPAAMPGWYGVAALFDDMSFDRDDRVPARFLKL
Ga0210384_1163973023300021432SoilMVTKAHVSRMEAAAMPGWYGVAAAFDDVEFDRDDGLPTRFLKR
Ga0210392_1128278313300021475SoilVKRLEPAATPGWYGVAALFEDVAFDRDDRVPTRFME
Ga0210402_10015494103300021478SoilVRRIEPAAMPGWYGVAASFDDVQFDRDDRVPSRFLQP
Ga0210402_1168300313300021478SoilVVIVSSARVQRIEPAAMPGWYGVAAAFDDVHFDRDDGLPSRFLRP
Ga0210409_1004494133300021559SoilVERAEPAAMPNWYGIAASFVDMQFDRDDVLPSRFLSS
Ga0210409_1066778423300021559SoilHVRRIHPAAVPGWYGIAANFDDVSFDRDDFIPSRFLGT
Ga0126371_1353050113300021560Tropical Forest SoilSVLMTTMAHVCRTEAAAMPGWYGLAACFDDVQFDHDDGMPSRFLKP
Ga0212123_1094061213300022557Iron-Sulfur Acid SpringQRLEPAAMPGWYGVAASFDDLKFDRDDGVPSRFPEL
Ga0208935_101571523300025414PeatlandRVQRLEPAAMPRWYGVAALFDDMSFDRDDRVPSRFLSL
Ga0207699_1052317323300025906Corn, Switchgrass And Miscanthus RhizosphereAARVKRLEPAATPGWYGIAALFEDVAFDRDDHIPTRFMK
Ga0209802_112001913300026328SoilNVVMATMAHVCRTEAAAMPSWYGVAASFDDVAFDRDDRVPARFLKP
Ga0209804_108879233300026335SoilCRAETAATPGWYGIAAAFDDVQFDRDDRIPSRYLKP
Ga0179587_1002700713300026557Vadose Zone SoilLGLGNVVATTMARVCRTETAAMPGWHGIAAAFDDVQFDRDDRIPSRYLKP
Ga0209179_112808623300027512Vadose Zone SoilARVCRTELAAMPGWFGVAAAFDDVQFDRDDSIPSRYLKP
Ga0209118_104471733300027674Forest SoilVATMAHVRRAETAAMPGWYGIAAAFDDVQFDRDDRIPSRFLKP
Ga0209773_1015607233300027829Bog Forest SoilHGSVVIVSTARVQRIEPAAMPGWYGVAAAFDDVKFDRDDGLPSRFLRP
Ga0209701_1070675013300027862Vadose Zone SoilQRYEPAAMQGWYGIAATFDDVQFDRDDRVPSRYLKP
Ga0209283_1088708613300027875Vadose Zone SoilRCDPAATPGWHGIAASFDDVQFDRDDRVPSRFLKP
Ga0209380_1039147223300027889SoilVVVATTARVRRLEPAATPGWFGVAVLFDDMSFDRDDRVPSRFLSL
Ga0209069_1052467723300027915WatershedsQRVDPAAMPGWYGIAASYDDVQFDRDDSIPSRFLK
Ga0308309_1024263933300028906SoilTAARVKRLEPAATPGWYGVAALFEDVAFDRDDRVPSRFME
Ga0308309_1156471123300028906SoilKRLEPAATPGWYGVAALFEDVVFDRDDRVPVRYTK
Ga0222749_1042194823300029636SoilATMARVQRLEPAAMPGWFGVAASFDEVQFDRDDHVPARFLNP
Ga0222749_1068081823300029636SoilVMATMAHVCRTEPAAMPGWHGIAAAFDDVQFDRDDHIPSRYLKP
Ga0310686_10106460013300031708SoilKAHVRRMEAAAMPGWYGVAAAFDDVQFDRDDGLPTRFLKR
Ga0307474_1083180413300031718Hardwood Forest SoilIVTKARAERVEPAAMPGWHGVAASFDDVQFDRDDGLPSRFQRP
Ga0307469_1107344713300031720Hardwood Forest SoilVRRVEPAAMPGWFGVAAAFDDVEFDRDDGLPFRFQNY
Ga0318517_1023769723300031835SoilGRGSVVMTTMAHVCRSEAAATPGWYGLAALFDDVQFDHDDDLPSRFRKP
Ga0306919_1056575813300031879SoilAHVCRAEAAATPGWYELAACFDDVQFDHDDDLPSRFLKP
Ga0307479_1174006013300031962Hardwood Forest SoilVVVATMAHVCRADAAAMPGWYGIAAVFDDVQFDRDDRMPSRFLNA
Ga0306922_1016239613300032001SoilSVVMTTMAHVCRAEAAATPGWYELAACFDDVQFDHDDDLPSRFLKP
Ga0307471_10122155923300032180Hardwood Forest SoilVVMVTRARVRRIEPAAMPGWFGIAAAFDDVEFDRDDGLPSRFQKP
Ga0370484_0227677_14_1453300034125Untreated Peat SoilMVSLARVRRVQPAATPGWFGIAASFDDVQFDRDDCVPSRFHDV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.