Basic Information | |
---|---|
Family ID | F086027 |
Family Type | Metagenome |
Number of Sequences | 111 |
Average Sequence Length | 43 residues |
Representative Sequence | VVANINEDVMGPMRADFERVARKRILSGFQDEQGEWTCVVL |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.20 % |
% of genes from short scaffolds (< 2000 bps) | 93.69 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.991 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.910 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.937 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 15.94% Coil/Unstructured: 63.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF08482 | HrpB_C | 37.84 |
PF01904 | DUF72 | 22.52 |
PF01019 | G_glu_transpept | 2.70 |
PF01402 | RHH_1 | 1.80 |
PF12796 | Ank_2 | 1.80 |
PF13620 | CarboxypepD_reg | 1.80 |
PF02653 | BPD_transp_2 | 0.90 |
PF04185 | Phosphoesterase | 0.90 |
PF02687 | FtsX | 0.90 |
PF01255 | Prenyltransf | 0.90 |
PF13751 | DDE_Tnp_1_6 | 0.90 |
PF13673 | Acetyltransf_10 | 0.90 |
PF12543 | DUF3738 | 0.90 |
PF03447 | NAD_binding_3 | 0.90 |
PF04069 | OpuAC | 0.90 |
PF05168 | HEPN | 0.90 |
PF09364 | XFP_N | 0.90 |
PF01522 | Polysacc_deac_1 | 0.90 |
PF01050 | MannoseP_isomer | 0.90 |
PF13637 | Ank_4 | 0.90 |
PF00196 | GerE | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG1643 | HrpA-like RNA helicase | Translation, ribosomal structure and biogenesis [J] | 37.84 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 22.52 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 2.70 |
COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 0.90 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.90 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.90 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.99 % |
Unclassified | root | N/A | 9.01 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459014|G1P06HT02JDRCV | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
2170459017|G14TP7Y01BOGD1 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102637217 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300004092|Ga0062389_101255444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
3300005340|Ga0070689_100206474 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300005340|Ga0070689_100274009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
3300005439|Ga0070711_101115523 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005444|Ga0070694_100120193 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
3300005468|Ga0070707_101850869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300005535|Ga0070684_100251575 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
3300005541|Ga0070733_10640994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 713 | Open in IMG/M |
3300005578|Ga0068854_100904824 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300005602|Ga0070762_11109478 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005616|Ga0068852_100264421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1653 | Open in IMG/M |
3300005616|Ga0068852_100783128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
3300005836|Ga0074470_11351120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 659 | Open in IMG/M |
3300005841|Ga0068863_100451784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 1261 | Open in IMG/M |
3300006057|Ga0075026_100294992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
3300006059|Ga0075017_100842093 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300006174|Ga0075014_100419790 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300006755|Ga0079222_12096497 | Not Available | 559 | Open in IMG/M |
3300006893|Ga0073928_11109825 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300009093|Ga0105240_11169679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 816 | Open in IMG/M |
3300009098|Ga0105245_11017835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 873 | Open in IMG/M |
3300009098|Ga0105245_12648025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300009162|Ga0075423_12963929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300009174|Ga0105241_10322388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1333 | Open in IMG/M |
3300009174|Ga0105241_10770172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300009174|Ga0105241_12039656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300009176|Ga0105242_12893187 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300009177|Ga0105248_13150018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 525 | Open in IMG/M |
3300009545|Ga0105237_10185800 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
3300009545|Ga0105237_10247894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1783 | Open in IMG/M |
3300009551|Ga0105238_10103185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2833 | Open in IMG/M |
3300009553|Ga0105249_12301229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300009700|Ga0116217_10360204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 927 | Open in IMG/M |
3300010366|Ga0126379_11658088 | Not Available | 744 | Open in IMG/M |
3300010373|Ga0134128_11490294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 745 | Open in IMG/M |
3300010375|Ga0105239_11211801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
3300010376|Ga0126381_100032349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6251 | Open in IMG/M |
3300010379|Ga0136449_100319704 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
3300010398|Ga0126383_11288501 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300011119|Ga0105246_11896003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300012200|Ga0137382_10961048 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300012683|Ga0137398_11036837 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300012917|Ga0137395_11237677 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300013296|Ga0157374_11308355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300013297|Ga0157378_11444283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300014325|Ga0163163_10164594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2264 | Open in IMG/M |
3300014489|Ga0182018_10438189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300014657|Ga0181522_10930592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300014969|Ga0157376_12435048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 563 | Open in IMG/M |
3300017822|Ga0187802_10159539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
3300017955|Ga0187817_10907153 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300017975|Ga0187782_10798244 | Not Available | 730 | Open in IMG/M |
3300018033|Ga0187867_10623472 | Not Available | 589 | Open in IMG/M |
3300018037|Ga0187883_10333255 | Not Available | 775 | Open in IMG/M |
3300018089|Ga0187774_11447644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium | 506 | Open in IMG/M |
3300019786|Ga0182025_1360288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1376 | Open in IMG/M |
3300020580|Ga0210403_10723993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 796 | Open in IMG/M |
3300020581|Ga0210399_10544878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 962 | Open in IMG/M |
3300020581|Ga0210399_10819979 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300020583|Ga0210401_10702727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300021168|Ga0210406_10426365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 1059 | Open in IMG/M |
3300021181|Ga0210388_11373548 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300021432|Ga0210384_10753671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
3300021432|Ga0210384_10754684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 869 | Open in IMG/M |
3300021474|Ga0210390_11561393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300021560|Ga0126371_13526605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300022213|Ga0224500_10179483 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300023270|Ga0247784_1108570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300025920|Ga0207649_10655700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 811 | Open in IMG/M |
3300025922|Ga0207646_10490773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
3300025927|Ga0207687_10609817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
3300025927|Ga0207687_10684239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 869 | Open in IMG/M |
3300025934|Ga0207686_10017264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4065 | Open in IMG/M |
3300026035|Ga0207703_10167642 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300026088|Ga0207641_10423364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 1282 | Open in IMG/M |
3300026116|Ga0207674_12289119 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300027641|Ga0208827_1115844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 778 | Open in IMG/M |
3300027674|Ga0209118_1164221 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300027869|Ga0209579_10393436 | Not Available | 751 | Open in IMG/M |
3300027879|Ga0209169_10282953 | Not Available | 870 | Open in IMG/M |
3300027879|Ga0209169_10312389 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300027889|Ga0209380_10306683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300027889|Ga0209380_10647450 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300027986|Ga0209168_10461356 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300028381|Ga0268264_10657437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
3300029923|Ga0311347_10555781 | Not Available | 698 | Open in IMG/M |
3300029951|Ga0311371_11218174 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300030020|Ga0311344_11355365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300030503|Ga0311370_11001224 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300031236|Ga0302324_101069656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300031249|Ga0265339_10415745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300031474|Ga0170818_111043923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300031525|Ga0302326_12930009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300031595|Ga0265313_10383593 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031708|Ga0310686_115399555 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300031715|Ga0307476_11242054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
3300031740|Ga0307468_101672398 | Not Available | 598 | Open in IMG/M |
3300031947|Ga0310909_11293966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300031954|Ga0306926_10896609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
3300032001|Ga0306922_11686434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300032060|Ga0318505_10392740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300032160|Ga0311301_10419044 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
3300032205|Ga0307472_102078523 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300032515|Ga0348332_12371996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300032783|Ga0335079_11330064 | Not Available | 716 | Open in IMG/M |
3300032955|Ga0335076_10761915 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300033158|Ga0335077_11938655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300033475|Ga0310811_11274734 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.21% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.60% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.60% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.70% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.80% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.80% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.80% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.90% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.90% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.90% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.90% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.90% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.90% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.90% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.90% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.90% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.90% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.90% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2PV_02683410 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | AVATNAFDVVVANISEIVIGDLKPEFERVAPRRILSGFQDAAGEWTCVVE |
4ZMR_03057340 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | NINEDVMGSMGADLERVARTRILSGFQDDAGEWTCVVI |
JGIcombinedJ13530_1026372173 | 3300001213 | Wetland | NISEDVIGDMYPDFERVAKVRILSGFQDESGEWTCVIR* |
Ga0062389_1012554441 | 3300004092 | Bog Forest Soil | RSGAFDVVVANINEDVVGELRPEFERVARVRILSGFQDEAGEWCCVVG* |
Ga0070689_1002064744 | 3300005340 | Switchgrass Rhizosphere | INEDVIGCMLPDFERVARVRILSGFQDDKGEWTYVVRGSH* |
Ga0070689_1002740091 | 3300005340 | Switchgrass Rhizosphere | VVVANINEDVMGPMLPDFVRVARKRILSGFQGDAGDWTCVIL* |
Ga0070711_1011155231 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GAFDVVVANISEVVIGDLKAEFERVAPRRILSGFQDARGEWTCVTR* |
Ga0070694_1001201931 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | NSFDIVVANINEEVLDGPLRAELERVAPKRILSGFQDEHGDWTCVVA* |
Ga0070707_1018508692 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AVATDAFDVVVANISEIVIGDLKPEFERVAPRRILSGFQDAAGEWTCVVE* |
Ga0070684_1002515752 | 3300005535 | Corn Rhizosphere | SGAFDVVVANINEDVMGSMRGDFERVARIRILSGFQNDDGEWDCVVI* |
Ga0070733_106409941 | 3300005541 | Surface Soil | NEDVVGSMRADFERVAPVRILSGFQDDDGEWTCVVI* |
Ga0068854_1009048241 | 3300005578 | Corn Rhizosphere | SVDAVRSGAFDVVVANISEVVIGDLKAEFERVAPRRILSGFQDERGEWTCVVA* |
Ga0070762_111094781 | 3300005602 | Soil | FDIVVANISDEVLGSLRADFERVARRRILSGFQDEAGEWACVVR* |
Ga0068852_1002644211 | 3300005616 | Corn Rhizosphere | FDVVVANISEVVIGDLKAEFERVAPRRILSGFQDARGEWTCVTR* |
Ga0068852_1007831282 | 3300005616 | Corn Rhizosphere | VVANINENVIGPMRADFERVARVRILSGFQNDDGEWTCMIL* |
Ga0074470_113511202 | 3300005836 | Sediment (Intertidal) | ANISEDVMGPMRGDLERVARKRILSGFQDDDGEWTCVVL* |
Ga0068863_1004517842 | 3300005841 | Switchgrass Rhizosphere | ISEIVIGDLKPEFERVAPRRILSGFQDAAGEWTCVVE* |
Ga0075026_1002949921 | 3300006057 | Watersheds | GAFDVVVANISEIVMGELKPELERVAPRRILSGFQDDRGEWTCVVTP* |
Ga0075017_1008420931 | 3300006059 | Watersheds | FDVVVANISEVVLGDLKAEFERVAPRRILSGFQDARGEWTCVTR* |
Ga0075014_1004197901 | 3300006174 | Watersheds | ANISEVVIGELKAEFERVAPRRILSGFQDDMGEWACITL* |
Ga0079222_120964972 | 3300006755 | Agricultural Soil | DVIGWMRPDFERVARTRILSGFRDHHGNWTCLVC* |
Ga0073928_111098252 | 3300006893 | Iron-Sulfur Acid Spring | AVRDHAFDVVVSNIGEEVLGRLRPDLERVAPRRILSGFQNEAGEWACLIL* |
Ga0105240_111696792 | 3300009093 | Corn Rhizosphere | VVVANINENVIGPMRADFERVARVRILSGFQNDDGEWTCMIL* |
Ga0105245_110178352 | 3300009098 | Miscanthus Rhizosphere | GAFDVVVANINEDVMGSMRADLERVARRRILSGFQDGDGEWTCVVI* |
Ga0105245_126480252 | 3300009098 | Miscanthus Rhizosphere | DVMGSMRADFERVARTRILSGFQDDDGEWTCVIL* |
Ga0075423_129639291 | 3300009162 | Populus Rhizosphere | NINEDVMGSMRADLERVARTRILSGFQDDAGDWTCVIL* |
Ga0105241_103223881 | 3300009174 | Corn Rhizosphere | IVIGELKADFERVAPRRILSGFQDIRGEWTCVTL* |
Ga0105241_107701721 | 3300009174 | Corn Rhizosphere | DAFDVVVANINEDVMGPMLPDFVRVARKRILSGFQGDAGDWTCVIL* |
Ga0105241_120396561 | 3300009174 | Corn Rhizosphere | SEIVIGDLKPEFDRVAPKRILSGFQDAAGEWTCVVD* |
Ga0105242_128931871 | 3300009176 | Miscanthus Rhizosphere | NTFDLVVANINEDVVGSMRADFERVAPKRILSGFQDDDNEWTCVVI* |
Ga0105248_131500181 | 3300009177 | Switchgrass Rhizosphere | RSFDIVVANINEEVLDGPLRAELERVAKKRILSGFRDDNGEWTCVVA* |
Ga0105237_101858002 | 3300009545 | Corn Rhizosphere | FDVVVANINEDVVGSMRADFERVARVRILSGFQNDDGEWTCVTI* |
Ga0105237_102478941 | 3300009545 | Corn Rhizosphere | VANISEVVIGDLKAEFERVAPRRILSGFQDARGEWTCVTR* |
Ga0105238_101031851 | 3300009551 | Corn Rhizosphere | NEDVVGCMRPDFERVARKRILSGFQDDDGQWTCVTL* |
Ga0105249_123012292 | 3300009553 | Switchgrass Rhizosphere | DAVRSGSFDVVVANINEDVIGSMRPDFERVAQRRILSGFQDDTGDWTCVIL* |
Ga0116217_103602042 | 3300009700 | Peatlands Soil | VVANINETVIEDLRAEFERVAPRRILSGFQDDSGNWTCLVC* |
Ga0126379_116580881 | 3300010366 | Tropical Forest Soil | VANISEDVLGPLRPDLERVARTRILSGFQDESGKWACVVV* |
Ga0134128_114902942 | 3300010373 | Terrestrial Soil | DVVVANINEDVIGPMRADFERVARLRILSGFQNDDGEWTCVTL* |
Ga0105239_112118011 | 3300010375 | Corn Rhizosphere | VVANINEDVMGSMRADFERVARTRILSGFQDDDGEWTCVIL* |
Ga0126381_1000323494 | 3300010376 | Tropical Forest Soil | DAVRSGSFDVVVANINEDVIGDMRLDLERVAAVRILSGFQNESGEWTCVIT* |
Ga0136449_1003197041 | 3300010379 | Peatlands Soil | NEDVMGSMRADFERVARVRILSGFQDDDGEWTCLVI* |
Ga0126383_112885012 | 3300010398 | Tropical Forest Soil | DVVVANINEDVTGSMHPDFVRVARRRILSGFQDDNGKWTRVVE* |
Ga0105246_118960031 | 3300011119 | Miscanthus Rhizosphere | NINEDVMGPMRADFERVARKCILSGFQDEQGEWTCVVL* |
Ga0137382_109610482 | 3300012200 | Vadose Zone Soil | FDLVVANISEIVMGELKLELERVAPRRILSGFQDHRGEWTCVVE* |
Ga0137398_110368372 | 3300012683 | Vadose Zone Soil | VVVANISEIVMGELKPELERVAPRRILSGFHDHRGEWTCVVE* |
Ga0137395_112376772 | 3300012917 | Vadose Zone Soil | VVANISEIVIGYLKPEFDRIAPRRILSGFQDAEGDWTCVVE* |
Ga0157374_113083552 | 3300013296 | Miscanthus Rhizosphere | GSNTFDVVVANINEDVVGSMRADFERVAPKRILSGFQDEDGDWTCVLI* |
Ga0157378_114442831 | 3300013297 | Miscanthus Rhizosphere | SEIVMGNLKPELERVAPRRILSGFQDASGEWTCVVE* |
Ga0163163_101645943 | 3300014325 | Switchgrass Rhizosphere | FDVVIANISEDVIGSMRPDFERVGRKRILSGFRDDAGEWTCVIL* |
Ga0182018_104381892 | 3300014489 | Palsa | FDVVVANINEDVIGALRPEFERVARKRILSGFQDETGEWACVEL* |
Ga0181522_109305922 | 3300014657 | Bog | VVANISEAVIEDLRPEFVRVARRRILSGFQDDRGEWTCVVE* |
Ga0157376_124350482 | 3300014969 | Miscanthus Rhizosphere | VVANINEDVMGPMRADFERVARKRILSGFQDEQGEWTCVVL* |
Ga0187802_101595393 | 3300017822 | Freshwater Sediment | INEDVIGVLRPEFERVARRRILSGFQDEDGEWTCVEC |
Ga0187817_109071532 | 3300017955 | Freshwater Sediment | DVVVANINESVIEDLREEFTRVAKRKILSGFQDDDGRWTCVCE |
Ga0187782_107982441 | 3300017975 | Tropical Peatland | NINEDELGSLRSELERVARTRILSGFQDERGEWACVVL |
Ga0187867_106234721 | 3300018033 | Peatland | ISEIVIGALRLEFERVARKRILSGFQDQQGQWTCLSSET |
Ga0187883_103332551 | 3300018037 | Peatland | EAVVEDLREEFERVAPVRILSGFQDDLGEWTCVVS |
Ga0187774_114476441 | 3300018089 | Tropical Peatland | AGAFDLVVANISDAVIGELKPEFDRAAPRRILSGFQNEQGDWACVVEED |
Ga0182025_13602881 | 3300019786 | Permafrost | GEEVLGRLRPDLERVARRRILSGFQDESGEWACVIL |
Ga0210403_107239932 | 3300020580 | Soil | AVRSGTFDVVVANINEDVMGPMRADFERVARTRILSGFQDDAGEWTCIVL |
Ga0210399_105448782 | 3300020581 | Soil | AFDVVVANINEEVIGKMRPDFERVAKHQILSGFQDEEGEWTCFAR |
Ga0210399_108199792 | 3300020581 | Soil | VDAVRSGTFDVVVANINEDVMGPMRADFERVARTRILSGFQDDAGEWTCIVL |
Ga0210401_107027271 | 3300020583 | Soil | AVRTGSFDVVVANINESVIEDLRPDLERVAARRILSGFQDAHGEWTCVISGT |
Ga0210406_104263651 | 3300021168 | Soil | VANINEDVMGSMRADFERVARKRILSGFQNDAGEWDCVVI |
Ga0210388_113735481 | 3300021181 | Soil | IVVANISDEVLGSLRADFERVARRRILSGFQDEAGEWACVVR |
Ga0210384_107536712 | 3300021432 | Soil | EDVIGRMRPDFERVARRRILSGFQDDEGEWTCAVC |
Ga0210384_107546842 | 3300021432 | Soil | INEDVIGPMLPEFERVARRRILSGFQDERGEWTCVVS |
Ga0210390_115613931 | 3300021474 | Soil | DAVRDNSFDVVVANINEDVIGAMRPDLERVAKRRILSGFQDGEGEWTCIVC |
Ga0126371_135266051 | 3300021560 | Tropical Forest Soil | PFDVVVANISEDVLGSLRPDLERVAQTRILSGFQNESGEWTCIVV |
Ga0224500_101794833 | 3300022213 | Sediment | NAFDVVVANISEEVVGHMLPDFQRVAKTRILSGFQDENGEWTAQVW |
Ga0247784_11085702 | 3300023270 | Plant Litter | ANINEDVIGSMLPDFERVAKTRILSGFQDDHGEWTCVIR |
Ga0207649_106557001 | 3300025920 | Corn Rhizosphere | DDGAFDVVVANINEDVIGPMRADFERVARLRILSGFQNDDGEWTCVTL |
Ga0207646_104907732 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVRSDTFDLVVANINEDVIGSMRADFERVAPKRILSGFQDDDNEWTCVVL |
Ga0207687_106098171 | 3300025927 | Miscanthus Rhizosphere | NVVVANISEIVMGNLKPELERVAPRRILSGFQDASGEWTCVVE |
Ga0207687_106842392 | 3300025927 | Miscanthus Rhizosphere | FDVVVANINEDVMGSMRADLERVARRRILSGFQDGDGEWTCVVI |
Ga0207686_100172643 | 3300025934 | Miscanthus Rhizosphere | DAVRSNSFDIVVANISEDVIGEMLPDFERVAQVRILSGFQDDQGEWTCIVR |
Ga0207703_101676421 | 3300026035 | Switchgrass Rhizosphere | EDVIGSMRADFERVARVRILSGFQNDDGEWTCVTI |
Ga0207641_104233641 | 3300026088 | Switchgrass Rhizosphere | VVGANIREIVIGDLKPEFERVAPRRILSGFQDAAGEWTCVVE |
Ga0207674_122891192 | 3300026116 | Corn Rhizosphere | VVVANINEDVIGSMRADFERVARVRILSGFQNDDGEWTCVTI |
Ga0208827_11158441 | 3300027641 | Peatlands Soil | NEDVIGPLRAEFERVARTRILSGFQDEHGEWACVTL |
Ga0209118_11642211 | 3300027674 | Forest Soil | VVANISEAVMGEMRAELERVASKRILSGFQDERGEWACVVC |
Ga0209579_103934361 | 3300027869 | Surface Soil | INESVIEGLHPEFVRVARRRILSGFRDDRGEWACIVE |
Ga0209169_102829532 | 3300027879 | Soil | ANINEDVIGEMRADFERVAQRRILSGFQDERGEWTCVCL |
Ga0209169_103123892 | 3300027879 | Soil | VVANINESVIEDLREEFTRVARRQILSGFQDESGAWTCVLAANEGE |
Ga0209380_103066831 | 3300027889 | Soil | VANINEDVIGAMRPDLERVATRRILSGFQDEEGNWTCVVY |
Ga0209380_106474502 | 3300027889 | Soil | DAVRDDAFDIVVANISDEVLGSLRADFERVARRRILSGFQDEAGEWACVVR |
Ga0209168_104613562 | 3300027986 | Surface Soil | VRSGGFDVVVANISEVVIGELKAEFERVAPRRILSGFQDARGEWTCVTR |
Ga0268264_106574371 | 3300028381 | Switchgrass Rhizosphere | AVRSNTFDLVVANINEDVVGSMRADFERVAPKRILSGFQDDDNEWTCVVI |
Ga0311347_105557811 | 3300029923 | Fen | ANISEAVIEDLHPEFVRVARRRILSGFQDANGAWTCVVE |
Ga0311371_112181741 | 3300029951 | Palsa | VRDNSFDVVVANINEEVIGAMRPDFERVAKHRILSGFQNEEGEWTCIVC |
Ga0311344_113553652 | 3300030020 | Bog | AAFDVVVANISEAVMEDLHPEFVRVARRRILSGFQDANGEWTCVVE |
Ga0311370_110012241 | 3300030503 | Palsa | DAVRDNSFDVVVANINEEVIGVMRPDFERVAKHRILSGFQNEEGEWTCIVC |
Ga0302324_1010696561 | 3300031236 | Palsa | SNIGEEVLGRVRPDLERVARRRILSGFQDESGDWACVIL |
Ga0265339_104157452 | 3300031249 | Rhizosphere | VGAVRSGAFDVVVANINEDVIGSMRPDFERVARVRILSGFQDDDGEWTCVIA |
Ga0170818_1110439231 | 3300031474 | Forest Soil | RSATFDVVVANINEDVVGCMLADFERVAPKRILSGFQNDDGDWTCVVI |
Ga0302326_129300092 | 3300031525 | Palsa | DAVRSNSFDVVVANINEEVIGRMRPDFDRVARHRILSGFQNEDGEWTCLVC |
Ga0265313_103835932 | 3300031595 | Rhizosphere | GVFDIVVANISEVVVGDLKFEFERVAPRRILSGFQDARGEWTCVTT |
Ga0310686_1153995553 | 3300031708 | Soil | VVVANISEIVIGDLKAEFERVAPRRILSGFQDARGEWTCVTT |
Ga0307476_112420542 | 3300031715 | Hardwood Forest Soil | NINEDVIGKLRPEFERVARRRILSGFQDENGEWACVEL |
Ga0307468_1016723981 | 3300031740 | Hardwood Forest Soil | VVANINEEVLDGPLRAELERVAKKRILSGFRDDAGDWTCVVA |
Ga0310909_112939662 | 3300031947 | Soil | AVRSGAFDVVVANISEDVIGPMRPEFERVARRRVLSGFQDKDGQWACVVL |
Ga0306926_108966091 | 3300031954 | Soil | VDAVRSGAFDVVVANINEDVIGSMRPDFERVAKRRILSGFQDKCGEWTCAVL |
Ga0306922_116864341 | 3300032001 | Soil | VANINEDVIGPMKHDFERVATHQILSGFQDTDGEWTIFCSFSAS |
Ga0318505_103927402 | 3300032060 | Soil | VRSGAFDVVVANISEDVLGPLRPDLERVARKRILSGFQNESGDWSCVVL |
Ga0311301_104190442 | 3300032160 | Peatlands Soil | NEDVMGSMRADFERVARVRILSGFQDDDGEWTCLVI |
Ga0307472_1020785231 | 3300032205 | Hardwood Forest Soil | AVRSRAFDVVVANISEVVIGELKAEFERVARRRILSGFQDARGEWTCVTR |
Ga0348332_123719962 | 3300032515 | Plant Litter | SGSFDVVVANISEDVIGPMRFDLERVAARRILSGFQNEDGEWTCVVC |
Ga0335079_113300642 | 3300032783 | Soil | EDVIGDLRPEFERVARTRILSGFQDERGEWACVVSEG |
Ga0335076_107619152 | 3300032955 | Soil | SVDAVRSGAFDVVVANINEDVVGDLRPEFERVARVRILSGFQDEDGEWTCVVV |
Ga0335077_119386551 | 3300033158 | Soil | VRSGAFDVVVANINEDVVGDLGPEFERVARVGILSGFQDEDGEWTCVVV |
Ga0310811_112747342 | 3300033475 | Soil | AVRSGAFDVVVANISEVVIGDLKAEFERVAPRRILSGFQDERGEWTCVVA |
⦗Top⦘ |