Basic Information | |
---|---|
Family ID | F085918 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 111 |
Average Sequence Length | 42 residues |
Representative Sequence | HSMIAMEHWDAAHFREQDAHSKATEAREAYKDALRAVNYGI |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.70 % |
% of genes near scaffold ends (potentially truncated) | 81.08 % |
% of genes from short scaffolds (< 2000 bps) | 89.19 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.568 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (15.315 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.441 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.955 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.62% β-sheet: 0.00% Coil/Unstructured: 46.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF01384 | PHO4 | 4.50 |
PF00171 | Aldedh | 3.60 |
PF00005 | ABC_tran | 2.70 |
PF03625 | DUF302 | 2.70 |
PF00155 | Aminotran_1_2 | 2.70 |
PF00491 | Arginase | 1.80 |
PF01966 | HD | 1.80 |
PF13620 | CarboxypepD_reg | 1.80 |
PF09656 | PGPGW | 1.80 |
PF00437 | T2SSE | 1.80 |
PF04366 | Ysc84 | 1.80 |
PF01380 | SIS | 1.80 |
PF08668 | HDOD | 0.90 |
PF00128 | Alpha-amylase | 0.90 |
PF02656 | DUF202 | 0.90 |
PF00871 | Acetate_kinase | 0.90 |
PF13508 | Acetyltransf_7 | 0.90 |
PF00685 | Sulfotransfer_1 | 0.90 |
PF02518 | HATPase_c | 0.90 |
PF12838 | Fer4_7 | 0.90 |
PF10431 | ClpB_D2-small | 0.90 |
PF08530 | PepX_C | 0.90 |
PF00723 | Glyco_hydro_15 | 0.90 |
PF04185 | Phosphoesterase | 0.90 |
PF06662 | C5-epim_C | 0.90 |
PF03544 | TonB_C | 0.90 |
PF13565 | HTH_32 | 0.90 |
PF13180 | PDZ_2 | 0.90 |
PF01451 | LMWPc | 0.90 |
PF11138 | DUF2911 | 0.90 |
PF03050 | DDE_Tnp_IS66 | 0.90 |
PF00571 | CBS | 0.90 |
PF05016 | ParE_toxin | 0.90 |
PF00196 | GerE | 0.90 |
PF00873 | ACR_tran | 0.90 |
PF00582 | Usp | 0.90 |
PF01557 | FAA_hydrolase | 0.90 |
PF00106 | adh_short | 0.90 |
PF01882 | DUF58 | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 4.50 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 3.60 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 3.60 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 3.60 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 2.70 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.80 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.80 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.90 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.90 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG0282 | Acetate kinase | Energy production and conversion [C] | 0.90 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.90 |
COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.90 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.90 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.90 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.90 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.90 |
COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.90 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.57 % |
Unclassified | root | N/A | 32.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100021810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5523 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100986049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300003350|JGI26347J50199_1030800 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300004080|Ga0062385_10133231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1258 | Open in IMG/M |
3300004080|Ga0062385_10184273 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300004082|Ga0062384_100182071 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300004082|Ga0062384_100355896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
3300004091|Ga0062387_100641772 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300004091|Ga0062387_100889780 | Not Available | 672 | Open in IMG/M |
3300004092|Ga0062389_100327383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1615 | Open in IMG/M |
3300004092|Ga0062389_101990591 | Not Available | 758 | Open in IMG/M |
3300004635|Ga0062388_100764118 | Not Available | 911 | Open in IMG/M |
3300005538|Ga0070731_10325648 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300005591|Ga0070761_10946600 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005602|Ga0070762_10593597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300005712|Ga0070764_10063125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1919 | Open in IMG/M |
3300005764|Ga0066903_100276027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2629 | Open in IMG/M |
3300006162|Ga0075030_100129677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2047 | Open in IMG/M |
3300006176|Ga0070765_101742579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis parvus | 585 | Open in IMG/M |
3300009623|Ga0116133_1073468 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300009623|Ga0116133_1074680 | Not Available | 848 | Open in IMG/M |
3300009638|Ga0116113_1020375 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300009759|Ga0116101_1041555 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300010046|Ga0126384_10969042 | Not Available | 772 | Open in IMG/M |
3300010339|Ga0074046_10903440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300010343|Ga0074044_10571840 | Not Available | 738 | Open in IMG/M |
3300010360|Ga0126372_12748936 | Not Available | 544 | Open in IMG/M |
3300011110|Ga0138578_1113732 | Not Available | 513 | Open in IMG/M |
3300011120|Ga0150983_12732737 | Not Available | 1616 | Open in IMG/M |
3300011120|Ga0150983_15485985 | Not Available | 609 | Open in IMG/M |
3300014152|Ga0181533_1110311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNHC220B00 | 1202 | Open in IMG/M |
3300014155|Ga0181524_10030117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3768 | Open in IMG/M |
3300014155|Ga0181524_10417204 | Not Available | 583 | Open in IMG/M |
3300014159|Ga0181530_10644126 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300014168|Ga0181534_10467396 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300014169|Ga0181531_10409767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus | 833 | Open in IMG/M |
3300014200|Ga0181526_10171927 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300014200|Ga0181526_10635910 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300014489|Ga0182018_10641513 | Not Available | 556 | Open in IMG/M |
3300016294|Ga0182041_10419292 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300016357|Ga0182032_11860686 | Not Available | 527 | Open in IMG/M |
3300017931|Ga0187877_1421047 | Not Available | 503 | Open in IMG/M |
3300017935|Ga0187848_10186701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
3300017946|Ga0187879_10256801 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300017946|Ga0187879_10786845 | Not Available | 531 | Open in IMG/M |
3300017948|Ga0187847_10005907 | All Organisms → cellular organisms → Bacteria | 8700 | Open in IMG/M |
3300017948|Ga0187847_10022107 | All Organisms → cellular organisms → Bacteria | 3909 | Open in IMG/M |
3300017948|Ga0187847_10427189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300017970|Ga0187783_10067830 | All Organisms → cellular organisms → Bacteria | 2628 | Open in IMG/M |
3300017970|Ga0187783_10608133 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300017975|Ga0187782_10932975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300018007|Ga0187805_10225226 | Not Available | 858 | Open in IMG/M |
3300018009|Ga0187884_10175167 | Not Available | 894 | Open in IMG/M |
3300018012|Ga0187810_10401064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300018018|Ga0187886_1252569 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300018030|Ga0187869_10112660 | Not Available | 1367 | Open in IMG/M |
3300018034|Ga0187863_10239014 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300018034|Ga0187863_10884494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300018038|Ga0187855_10502409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 706 | Open in IMG/M |
3300018042|Ga0187871_10126245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1458 | Open in IMG/M |
3300018044|Ga0187890_10613251 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300018044|Ga0187890_10657207 | Not Available | 591 | Open in IMG/M |
3300018047|Ga0187859_10108598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1462 | Open in IMG/M |
3300018085|Ga0187772_10359729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1007 | Open in IMG/M |
3300019278|Ga0187800_1695924 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300019284|Ga0187797_1447791 | All Organisms → cellular organisms → Bacteria | 9123 | Open in IMG/M |
3300020580|Ga0210403_10660445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300020581|Ga0210399_10488214 | Not Available | 1024 | Open in IMG/M |
3300020583|Ga0210401_10109513 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
3300021180|Ga0210396_10038102 | All Organisms → cellular organisms → Bacteria | 4434 | Open in IMG/M |
3300021181|Ga0210388_10265124 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300021402|Ga0210385_10365413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
3300021420|Ga0210394_10574146 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300021420|Ga0210394_10579923 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300021433|Ga0210391_10210585 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300022557|Ga0212123_10768359 | Not Available | 584 | Open in IMG/M |
3300022881|Ga0224545_1005137 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
3300023259|Ga0224551_1045355 | Not Available | 764 | Open in IMG/M |
3300024233|Ga0224521_1130085 | Not Available | 535 | Open in IMG/M |
3300025434|Ga0208690_1035235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300025498|Ga0208819_1102947 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 602 | Open in IMG/M |
3300027652|Ga0209007_1079530 | Not Available | 826 | Open in IMG/M |
3300027729|Ga0209248_10040310 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300027729|Ga0209248_10072210 | Not Available | 1048 | Open in IMG/M |
3300027783|Ga0209448_10127853 | Not Available | 850 | Open in IMG/M |
3300027825|Ga0209039_10310296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300027853|Ga0209274_10594792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300027869|Ga0209579_10615834 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300027874|Ga0209465_10664194 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300027898|Ga0209067_10708917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300028798|Ga0302222_10372132 | Not Available | 558 | Open in IMG/M |
3300028871|Ga0302230_10109022 | Not Available | 1104 | Open in IMG/M |
3300030580|Ga0311355_11771073 | Not Available | 525 | Open in IMG/M |
3300030991|Ga0073994_11790924 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300031249|Ga0265339_10329660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
3300031249|Ga0265339_10484918 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031258|Ga0302318_10532176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300031261|Ga0302140_10282425 | Not Available | 1420 | Open in IMG/M |
3300031446|Ga0170820_17588455 | Not Available | 671 | Open in IMG/M |
3300031524|Ga0302320_10074856 | All Organisms → cellular organisms → Bacteria | 5696 | Open in IMG/M |
3300031679|Ga0318561_10642658 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300031718|Ga0307474_11613167 | Not Available | 509 | Open in IMG/M |
3300031719|Ga0306917_10158429 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
3300031890|Ga0306925_10616434 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300031954|Ga0306926_12111446 | Not Available | 630 | Open in IMG/M |
3300032261|Ga0306920_104297959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter dinghuensis | 512 | Open in IMG/M |
3300032828|Ga0335080_11942460 | Not Available | 571 | Open in IMG/M |
3300033004|Ga0335084_10629529 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300033405|Ga0326727_10886669 | Not Available | 670 | Open in IMG/M |
3300033822|Ga0334828_069263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
3300033982|Ga0371487_0458039 | Not Available | 542 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 15.32% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 12.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.91% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.21% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.41% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.60% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.60% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.70% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.80% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.80% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.80% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.90% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.90% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1000218102 | 3300002245 | Forest Soil | MVAMEKWDDAHFREHDAHSRATAARDAYKDALRRANYGI* |
JGIcombinedJ26739_1009860491 | 3300002245 | Forest Soil | SMIAMEQWDGAHFREESAHAKATEAREAYKDGLRSANYGI* |
JGI26347J50199_10308002 | 3300003350 | Bog Forest Soil | MVAMEHWDTAHFTEEDTHTKATEAREAYKDGLRSANYGI* |
Ga0062385_101332313 | 3300004080 | Bog Forest Soil | TTDHSMTEMERWDAAHFAEQDAQQKATEAREGYKDSLRKVNYGI* |
Ga0062385_101842734 | 3300004080 | Bog Forest Soil | EEALATSDHSMIAMEKWDDAHFAEHKAHDQASKAREAYKDGLRLANYGI* |
Ga0062384_1001820711 | 3300004082 | Bog Forest Soil | PDNSMIAWEKWDAAHFQEDDAHANATKAREAYKDALRAINIGI* |
Ga0062384_1003558963 | 3300004082 | Bog Forest Soil | MIAMEKWDDAHFAEHKAHDQASKAREAYKDGLRLANYGI* |
Ga0062387_1006417721 | 3300004091 | Bog Forest Soil | MTAMEKWDDAHFKEHDAHAKATEAREAYKSGLRDANYGI* |
Ga0062387_1008897801 | 3300004091 | Bog Forest Soil | MIAMEHWDAAHFREQDAHSKATEAREAYKDALRAVNYGI* |
Ga0062389_1003273833 | 3300004092 | Bog Forest Soil | EEALATPDHSMIAMEHWDAAHFKEHDAHQKATEAREAYKDGLRRVNYGI* |
Ga0062389_1019905912 | 3300004092 | Bog Forest Soil | HSMIAMEHWDAAHFREQDAHSKATEAREAYKDALRAVNYGI* |
Ga0062388_1007641182 | 3300004635 | Bog Forest Soil | MIAMEKWDAAHFTEHDAHTKATEAREAYKDGLRGVNYGI* |
Ga0070731_103256483 | 3300005538 | Surface Soil | ATPDHSMTAMEKWDDAHFREEDAHKAAVEARDAYKDGLRKLNEGF* |
Ga0070761_109466002 | 3300005591 | Soil | AMEHWDDAHFKEQDAHEKATAARDAYKDALRGANYGI* |
Ga0070762_105935973 | 3300005602 | Soil | HWDAAHFREQDAHSKATEARETYKDALRALNYGI* |
Ga0070764_100631253 | 3300005712 | Soil | DHSMTAMEKWDDAHFKEQDAHSKATEARDAYKDGLRSVNYGI* |
Ga0066903_1002760271 | 3300005764 | Tropical Forest Soil | ATPDHSMTAMEKWDEARFTEQDAATRASEAREAYKSALRKVNYDF* |
Ga0075030_1001296771 | 3300006162 | Watersheds | EEALATPDHSMIAMEHWDAAHLKEHDAHTRTTEAREAYKDALRKVNYGM* |
Ga0070765_1017425791 | 3300006176 | Soil | PDHSMIAMEHWDAAHFREHDAHTKATQAREAYKDALRTVNYGI* |
Ga0116133_10734682 | 3300009623 | Peatland | MIAMEKWDDAHFRELDAHTKANKAREANKDGLRQVNYDI* |
Ga0116133_10746801 | 3300009623 | Peatland | EALATPDHSMIAMETWDEAHFKEHDAHAKVTAAREAYKDALRGVNYGI* |
Ga0116113_10203751 | 3300009638 | Peatland | LATPDHSMIAMERWDDAHFREHDSHAKVTEARDAYKDALRAMNYGI* |
Ga0116101_10415551 | 3300009759 | Peatland | PDHSMIAMEKWDDAHFRELDAHTKANKAREANKDGLRQVNYDI* |
Ga0126384_109690421 | 3300010046 | Tropical Forest Soil | MGLATPDHSIRAMEHWDAAHLTEQEAQAKATEAREAYKDVLREINYGI* |
Ga0074046_109034402 | 3300010339 | Bog Forest Soil | EEEALATPDHSMIAMEHWDAANFKEQDAKKKVVAAKEAYKDALRLFNYGI* |
Ga0074044_105718401 | 3300010343 | Bog Forest Soil | MEKWDDAHFKEDDAQKKATEARDAYKDGLRAVNYGI* |
Ga0126372_127489362 | 3300010360 | Tropical Forest Soil | LTAMEKREAARFTEQDAATRTAEKPKAYKSALRKVNYDF* |
Ga0138578_11137321 | 3300011110 | Peatlands Soil | VDEWVETIRAEETLATRDHSMIAMEKWDAAHFTEHYAHTKVTEAREAYKDGLRAVNYGI* |
Ga0150983_127327371 | 3300011120 | Forest Soil | IAMEHWDAAHFREQDAQSKATEAREAYKDALRAVNYGI* |
Ga0150983_154859851 | 3300011120 | Forest Soil | MTEMEQWDAAHFAEQAAQKKATEAREAHKDSLRKVNYGI* |
Ga0181533_11103112 | 3300014152 | Bog | DHSMIAMEAWDDAHFREHDAHTKVTGAREAYKDALRGVNYGI* |
Ga0181524_100301175 | 3300014155 | Bog | LATPDHSMIAMEKWDAAHFLEHDAHTKATEAREAYKDALRAVNYGI* |
Ga0181524_104172041 | 3300014155 | Bog | EAWDDAHFREHDAHTKVTEAREAYKDALRGVNYGI* |
Ga0181530_106441262 | 3300014159 | Bog | AWDDAHFREHDAHTKVTEAREAYKDALRGVNYGI* |
Ga0181534_104673962 | 3300014168 | Bog | HSMIAWEKWDAAHFKEHDSHLKATEKREAYKDELRRLNYGI* |
Ga0181531_104097673 | 3300014169 | Bog | LATPDHSMIAWEKWDDAHFREHDAHTKATAAREAYKDALRGVNYGI* |
Ga0181526_101719272 | 3300014200 | Bog | MIAMAAWDTAHFREHDAHTNATKACEAYQDALRGANYGI* |
Ga0181526_106359102 | 3300014200 | Bog | LATPDHSMTAMEHWDAAHFKEHDAHEKVTEAREAYKDALREVNYGI* |
Ga0182018_106415131 | 3300014489 | Palsa | ALASSDHSMIAMEKWDAAHFLEEDAHTKANEAREAYKDALRTVNYGI* |
Ga0182041_104192923 | 3300016294 | Soil | PDHSMTAMEHWDEAHFREQDAQTRMTGVREAYKDALRKANYGI |
Ga0182032_118606861 | 3300016357 | Soil | KAMEKWDDAHVTEQDAQARMAKAREAYKDALRRVNYGI |
Ga0187877_14210472 | 3300017931 | Peatland | DHSMIAMEAWDDAHFREHDAHTKATEAREAYQDALRGANYGI |
Ga0187848_101867011 | 3300017935 | Peatland | EKWDDAHFREEDAHAKATAAREAYKDGLRSANYGI |
Ga0187879_102568011 | 3300017946 | Peatland | MIAMEKWDDAHFRELDAHTKANKAREANKDGLRQVNYDI |
Ga0187879_107868451 | 3300017946 | Peatland | EEALATPDHSMIAMEKWDAAHFIEHDAHTKATEAREAYKDGLRGVNYGI |
Ga0187847_100059077 | 3300017948 | Peatland | MIAMAAWDTAHFREHDAHTNATKACEAYQDALRGANYGI |
Ga0187847_100221071 | 3300017948 | Peatland | MVAWERWDAAHFTEQDASAKATEAREAYKDALRAVNYGI |
Ga0187847_104271891 | 3300017948 | Peatland | ERWDDAHFREDDAHTKATEARETYKDGLRGANYGI |
Ga0187783_100678302 | 3300017970 | Tropical Peatland | MPFVPKELATPDHSETAMERWNDVGFREQQAHAKATAARDAYKDGLRLANYRF |
Ga0187783_106081332 | 3300017970 | Tropical Peatland | HSMTAMEEWDTAHFREQDAQEKATQAREKYKDELRRANYNI |
Ga0187782_109329751 | 3300017975 | Tropical Peatland | MPFVPKELATPDHSETAMERWNDVGFREQQAHAKATAARDAYKDGLRLANYGF |
Ga0187805_102252262 | 3300018007 | Freshwater Sediment | MIAMEKWDDAHFAEQDAQRKAKEARDEYKDGLRSVNYGI |
Ga0187884_101751672 | 3300018009 | Peatland | PDHSMIAMEAWDDAHFREHDAHTKVTEAREAYKDGLRGVNYGI |
Ga0187810_104010641 | 3300018012 | Freshwater Sediment | MIAMEHWDAAHFKEHDAHSKVTEAREAYKDMLRKVNYGI |
Ga0187886_12525692 | 3300018018 | Peatland | SMIAMEAWDDAHFREHDAHTKVTEAREAYKDGLRGVNYGI |
Ga0187869_101126601 | 3300018030 | Peatland | DHSMLAWEKWDDAHFREHDAHTKFTETREAYKDALRAINIGI |
Ga0187863_102390141 | 3300018034 | Peatland | TPDHSMIAMERWDAAHFKEHDAHQKATEAREAYKDGLRRVNYGI |
Ga0187863_108844942 | 3300018034 | Peatland | IAMEHWDATHFKEHDAHQKATEAREAYKDGLRRVNYGI |
Ga0187855_105024091 | 3300018038 | Peatland | MEKWDDAHFREQDAHSKYAEALEAYKDGLRNLNYGI |
Ga0187871_101262451 | 3300018042 | Peatland | EEALATSDHSIIAMEKWDAARFTEHDAHTKATEAREAYKDALRDDNCGF |
Ga0187890_106132511 | 3300018044 | Peatland | SMIAWEAWDAAHFKEHDAHTKAMEAREAYKDGLRGANYGI |
Ga0187890_106572071 | 3300018044 | Peatland | MEHWDAAHFREQDAHAKVTEAREAYKYALRGANYGI |
Ga0187859_101085982 | 3300018047 | Peatland | MIAMAAWDTAHFREHDAHTNATKAREAYQDALRGANYGI |
Ga0187772_103597292 | 3300018085 | Tropical Peatland | IAMERWDAAHLREHDAHAKATEAREAYQDALRGVNYGI |
Ga0187800_16959241 | 3300019278 | Peatland | SIGAIDDWEAAHFREHDAYSKAAAAREAYEGALRKVNYGF |
Ga0187797_144779113 | 3300019284 | Peatland | MTALEDWDAAHFREHDAHIRAAGAREAYKDALRRVNYGI |
Ga0210403_106604452 | 3300020580 | Soil | ATPDHSMIAMEHWDTAHFKEHDAHAKVTEARDAYKDGLRTVNYGI |
Ga0210399_104882141 | 3300020581 | Soil | TEEALATRDHSMIAMEHWDAAHFREQDAQSKAKEAREAYKDALRAVNYGI |
Ga0210401_101095133 | 3300020583 | Soil | ATPDHSMIAMEHWDAAHFREQDAQSKAKEAREAYKDALRAVNYGI |
Ga0210396_100381026 | 3300021180 | Soil | TPDHSMLAWEKWDDAHFREEDAHTKFSATREAYKDALRAVNIGI |
Ga0210388_102651241 | 3300021181 | Soil | TPDHSMVAMEKWDDAHLREHGTHEKVTQAREAYKDGLRAVNYGI |
Ga0210385_103654132 | 3300021402 | Soil | MEHWDFAHFKEHDAHQKATEAREAYKDGLRRLNYGI |
Ga0210394_105741462 | 3300021420 | Soil | ESLATPDHSMIAWEKWDEAHFREEDARAKFTEAREAYKDALRAVNIGI |
Ga0210394_105799232 | 3300021420 | Soil | DHSMTAMELWDAAHFREDDARTKATEARDAYKDALRDVNYGI |
Ga0210391_102105853 | 3300021433 | Soil | MTEMENWDAAHFAEQDAQQKATEAREAYKDSLRKVNYGI |
Ga0212123_107683592 | 3300022557 | Iron-Sulfur Acid Spring | MVATEKWDAAHFSEQDASEKAEKAREAYKDGVRFVNYGF |
Ga0224545_10051371 | 3300022881 | Soil | HSMIAMEQWDDAHFREHDAHSKVTEAREAYKDGLRGVNYGI |
Ga0224551_10453552 | 3300023259 | Soil | LATPDHSMIAMEKWDASHFEEEDAHAKVTKAREAYKAALRSMNYGI |
Ga0224521_11300852 | 3300024233 | Soil | HSMIAMEHWDTAHFREHDAHAKATEAREAYKDALRDVNYGI |
Ga0208690_10352351 | 3300025434 | Peatland | EALATADHSMIAMEKWDDAHFREEDAHTKATTAREAYKDGLREVNYGI |
Ga0208819_11029472 | 3300025498 | Peatland | AVEHWDTAHFKEHDAHSKVTEAREAYKDALRDVNYGI |
Ga0209007_10795301 | 3300027652 | Forest Soil | ATPDHSEVAMEKWDAVHFTEQDASAKATEAREAYKDALRGVNYGF |
Ga0209248_100403102 | 3300027729 | Bog Forest Soil | MEQWDAAHFAEQDAQKKGTEAREGYKDGLRKVNYGI |
Ga0209248_100722102 | 3300027729 | Bog Forest Soil | LATPDHSMIAWEKWDAAHFQEEDAHDKYTKAREAYKDALRGANIGI |
Ga0209448_101278531 | 3300027783 | Bog Forest Soil | HSMTAMELWDAAHLKEEDASTKAAESREAYKDGLRTINYGI |
Ga0209039_103102962 | 3300027825 | Bog Forest Soil | LATPDHSIIAMEHWDTAGFKEQDAQKAAISAKEAYKDALRLFNYGI |
Ga0209274_105947921 | 3300027853 | Soil | IAMEHWDDAHFKEQDAHEKATAARDAYKDALRGANYGI |
Ga0209579_106158341 | 3300027869 | Surface Soil | ATPDHSMTAMEKWDDAHFREEDAHKAAVEARDVYKDGLRKLNEGF |
Ga0209465_106641941 | 3300027874 | Tropical Forest Soil | MTAMEKWDEARFTEQDAATRASEAREAYKSALRKVNYDF |
Ga0209067_107089171 | 3300027898 | Watersheds | AMEHWDDAHFKEHDAHEKVTAARDAYKDALRSVNYGI |
Ga0302222_103721321 | 3300028798 | Palsa | WEDWDAAHLREQDAQAKVTDAREAYKDALRQINYNF |
Ga0302230_101090222 | 3300028871 | Palsa | MVAMEKWDDAHFTEHDAHSKATEAREAYKDALRKVNYGI |
Ga0311355_117710731 | 3300030580 | Palsa | SDHSMIAMEKWDAAHFLEEDAHSKANEAREAYKDALRTVNYGI |
Ga0073994_117909241 | 3300030991 | Soil | MTAMEQWDAAHFDEDNARKKAKEARDAYRDGLRGANYGI |
Ga0265339_103296601 | 3300031249 | Rhizosphere | TSDHSMIAMEKWDEAHFREHDAHAKVTEARDAYKDGLRGANYGI |
Ga0265339_104849181 | 3300031249 | Rhizosphere | HSMLAWEKWDAAHFKEHDAHGKVTEKREAYKDELRRLNYGI |
Ga0302318_105321761 | 3300031258 | Bog | TAMEHWDTAHFKEHDAHEKATAAREAYKNALRSVNYGI |
Ga0302140_102824253 | 3300031261 | Bog | CAEEDLATSDHSMTAWEKWDDAHFREHDAHTKATEAREAYKSALRKANYGI |
Ga0170820_175884552 | 3300031446 | Forest Soil | ATTDHSMTAMERWDDAHFKEQDAQPKAQQARDAYKDALRKANYGI |
Ga0302320_100748561 | 3300031524 | Bog | MEQWDDAHFREHDAHSKVTEAREAYKDGLRRVNYGI |
Ga0318561_106426581 | 3300031679 | Soil | TTDHSMTAMERWDEAHFREQDAQKKAAKACEAYKDALRAVNYSI |
Ga0307474_116131672 | 3300031718 | Hardwood Forest Soil | SMIAMEKWDDAHFKEHDAHEKATEAREAYKDGLRAVNYGI |
Ga0306917_101584292 | 3300031719 | Soil | EALATPDHSMTAMERWDEAHFREQDAQKKAAKACEAYKDALRAVNYGI |
Ga0306925_106164342 | 3300031890 | Soil | LATTDHSMTAMERWDEAHFREQDAQKKAAKACEAYKDALRAVNYSI |
Ga0306926_121114462 | 3300031954 | Soil | SMKAMEKWDDAHILEQDAQARVSKAREAYKDELRRVNYGI |
Ga0306920_1042979591 | 3300032261 | Soil | AAIRDEEALATPDHSMIAMEHWDAANFKERDAQKKVIAAKEAYKDALRLFNYGI |
Ga0335080_119424602 | 3300032828 | Soil | IAMEKWDAAHFTERSAHTKATEAREAYKDALRRVNYGF |
Ga0335084_106295291 | 3300033004 | Soil | MTAMEAWDDAHFKEQDAQEKTNQARDAYKDALRSVNYGI |
Ga0326727_108866692 | 3300033405 | Peat Soil | PDHSMTAMEKWDAAHFSEQDAQEKAAKACAAYKDALRSVNYGI |
Ga0334828_069263_2_112 | 3300033822 | Soil | MEQWDAAHFREHDAHTKATEAREAYKNELRGVNYGI |
Ga0371487_0458039_9_119 | 3300033982 | Peat Soil | MEHWDAAQFREQDAQAKATGAREAYKDALRGVNYGI |
⦗Top⦘ |