Basic Information | |
---|---|
Family ID | F085870 |
Family Type | Metagenome |
Number of Sequences | 111 |
Average Sequence Length | 46 residues |
Representative Sequence | VKALLLIVGVLIATAGGVITYRALYVEPKSAVVITDTGIRQIPNQAR |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 79.44 % |
% of genes near scaffold ends (potentially truncated) | 95.50 % |
% of genes from short scaffolds (< 2000 bps) | 90.99 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.072 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.009 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.342 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.766 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 13.33% Coil/Unstructured: 53.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF00378 | ECH_1 | 86.49 |
PF07238 | PilZ | 1.80 |
PF01638 | HxlR | 0.90 |
PF13766 | Obsolete Pfam Family | 0.90 |
PF02954 | HTH_8 | 0.90 |
PF02737 | 3HCDH_N | 0.90 |
PF00725 | 3HCDH | 0.90 |
PF00174 | Oxidored_molyb | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.80 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.90 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.90 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.90 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.90 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.90 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.90 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.07 % |
All Organisms | root | All Organisms | 27.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_41301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104304856 | Not Available | 677 | Open in IMG/M |
3300000549|LJQas_1025743 | Not Available | 686 | Open in IMG/M |
3300001867|JGI12627J18819_10054096 | Not Available | 1675 | Open in IMG/M |
3300004114|Ga0062593_102348589 | Not Available | 601 | Open in IMG/M |
3300004156|Ga0062589_101873648 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300004643|Ga0062591_101196739 | Not Available | 740 | Open in IMG/M |
3300005293|Ga0065715_10479791 | Not Available | 798 | Open in IMG/M |
3300005295|Ga0065707_10283151 | Not Available | 1034 | Open in IMG/M |
3300005330|Ga0070690_101593792 | Not Available | 529 | Open in IMG/M |
3300005334|Ga0068869_100268727 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300005365|Ga0070688_100719418 | Not Available | 775 | Open in IMG/M |
3300005440|Ga0070705_100358488 | Not Available | 1066 | Open in IMG/M |
3300005441|Ga0070700_101840832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300005456|Ga0070678_101682792 | Not Available | 597 | Open in IMG/M |
3300005458|Ga0070681_11300129 | Not Available | 650 | Open in IMG/M |
3300005518|Ga0070699_101583986 | Not Available | 600 | Open in IMG/M |
3300005545|Ga0070695_100200457 | Not Available | 1426 | Open in IMG/M |
3300005545|Ga0070695_100465952 | Not Available | 971 | Open in IMG/M |
3300005545|Ga0070695_101291312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300005546|Ga0070696_100757993 | Not Available | 796 | Open in IMG/M |
3300005546|Ga0070696_101220110 | Not Available | 636 | Open in IMG/M |
3300005547|Ga0070693_101640319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300005564|Ga0070664_100625143 | Not Available | 1000 | Open in IMG/M |
3300005617|Ga0068859_100811873 | Not Available | 1023 | Open in IMG/M |
3300005617|Ga0068859_101306062 | Not Available | 799 | Open in IMG/M |
3300005617|Ga0068859_102313968 | Not Available | 592 | Open in IMG/M |
3300005713|Ga0066905_102055512 | Not Available | 531 | Open in IMG/M |
3300005719|Ga0068861_102691614 | Not Available | 502 | Open in IMG/M |
3300005840|Ga0068870_10400595 | Not Available | 893 | Open in IMG/M |
3300005840|Ga0068870_10465927 | Not Available | 836 | Open in IMG/M |
3300005840|Ga0068870_10942700 | Not Available | 612 | Open in IMG/M |
3300005841|Ga0068863_100550141 | Not Available | 1139 | Open in IMG/M |
3300005884|Ga0075291_1014111 | Not Available | 914 | Open in IMG/M |
3300005889|Ga0075290_1030324 | Not Available | 696 | Open in IMG/M |
3300006196|Ga0075422_10470332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300006847|Ga0075431_102116617 | Not Available | 517 | Open in IMG/M |
3300006852|Ga0075433_10617225 | Not Available | 951 | Open in IMG/M |
3300006852|Ga0075433_11101521 | Not Available | 690 | Open in IMG/M |
3300006852|Ga0075433_11597041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300006880|Ga0075429_100548195 | Not Available | 1013 | Open in IMG/M |
3300006894|Ga0079215_11167386 | Not Available | 583 | Open in IMG/M |
3300006954|Ga0079219_10324005 | Not Available | 971 | Open in IMG/M |
3300007004|Ga0079218_10009221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4739 | Open in IMG/M |
3300007004|Ga0079218_12147751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300009100|Ga0075418_12344283 | Not Available | 582 | Open in IMG/M |
3300009156|Ga0111538_12940896 | Not Available | 596 | Open in IMG/M |
3300009162|Ga0075423_10574207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1188 | Open in IMG/M |
3300009174|Ga0105241_12363852 | Not Available | 530 | Open in IMG/M |
3300009177|Ga0105248_11235041 | Not Available | 845 | Open in IMG/M |
3300009789|Ga0126307_11216374 | Not Available | 610 | Open in IMG/M |
3300010038|Ga0126315_10728565 | Not Available | 649 | Open in IMG/M |
3300010038|Ga0126315_11261160 | Not Available | 503 | Open in IMG/M |
3300010041|Ga0126312_11161338 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010045|Ga0126311_10002592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 9106 | Open in IMG/M |
3300010045|Ga0126311_10023822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3675 | Open in IMG/M |
3300010045|Ga0126311_10942901 | Not Available | 703 | Open in IMG/M |
3300010047|Ga0126382_11350033 | Not Available | 647 | Open in IMG/M |
3300010166|Ga0126306_10287201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1264 | Open in IMG/M |
3300010166|Ga0126306_11173806 | Not Available | 630 | Open in IMG/M |
3300010373|Ga0134128_11359514 | Not Available | 783 | Open in IMG/M |
3300010375|Ga0105239_12019156 | Not Available | 669 | Open in IMG/M |
3300010397|Ga0134124_13084197 | Not Available | 510 | Open in IMG/M |
3300010401|Ga0134121_11815187 | Not Available | 637 | Open in IMG/M |
3300010403|Ga0134123_10996932 | Not Available | 853 | Open in IMG/M |
3300010403|Ga0134123_12027739 | Not Available | 634 | Open in IMG/M |
3300010403|Ga0134123_12106916 | Not Available | 624 | Open in IMG/M |
3300011269|Ga0137392_10312919 | Not Available | 1299 | Open in IMG/M |
3300012205|Ga0137362_10991878 | Not Available | 715 | Open in IMG/M |
3300012210|Ga0137378_11806162 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012951|Ga0164300_10869187 | Not Available | 567 | Open in IMG/M |
3300012957|Ga0164303_10717318 | Not Available | 676 | Open in IMG/M |
3300012960|Ga0164301_10739420 | Not Available | 745 | Open in IMG/M |
3300012960|Ga0164301_11223078 | Not Available | 605 | Open in IMG/M |
3300013296|Ga0157374_10501883 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300013306|Ga0163162_10441259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1434 | Open in IMG/M |
3300013306|Ga0163162_13403739 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300013308|Ga0157375_10109698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2856 | Open in IMG/M |
3300013308|Ga0157375_12478896 | Not Available | 619 | Open in IMG/M |
3300013308|Ga0157375_13633974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300014745|Ga0157377_10924526 | Not Available | 654 | Open in IMG/M |
3300014968|Ga0157379_10671433 | Not Available | 971 | Open in IMG/M |
3300014968|Ga0157379_12123330 | Not Available | 557 | Open in IMG/M |
3300015371|Ga0132258_10003309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 30571 | Open in IMG/M |
3300015371|Ga0132258_13009871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1168 | Open in IMG/M |
3300018027|Ga0184605_10514398 | Not Available | 520 | Open in IMG/M |
3300018028|Ga0184608_10474076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300021445|Ga0182009_10089890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1382 | Open in IMG/M |
3300025907|Ga0207645_10870701 | Not Available | 612 | Open in IMG/M |
3300025918|Ga0207662_11035118 | Not Available | 583 | Open in IMG/M |
3300025926|Ga0207659_11129646 | Not Available | 674 | Open in IMG/M |
3300025930|Ga0207701_10823608 | Not Available | 781 | Open in IMG/M |
3300025934|Ga0207686_11633756 | Not Available | 532 | Open in IMG/M |
3300025935|Ga0207709_10874337 | Not Available | 729 | Open in IMG/M |
3300025937|Ga0207669_11720226 | Not Available | 536 | Open in IMG/M |
3300025960|Ga0207651_11286155 | Not Available | 657 | Open in IMG/M |
3300025960|Ga0207651_11569434 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300025960|Ga0207651_11592413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300025960|Ga0207651_11599485 | Not Available | 587 | Open in IMG/M |
3300025960|Ga0207651_12118695 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300026041|Ga0207639_11283321 | Not Available | 687 | Open in IMG/M |
3300026118|Ga0207675_102471714 | Not Available | 531 | Open in IMG/M |
3300026121|Ga0207683_10470779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1159 | Open in IMG/M |
3300027639|Ga0209387_1015246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1427 | Open in IMG/M |
3300027907|Ga0207428_10104762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2182 | Open in IMG/M |
3300032004|Ga0307414_11994231 | Not Available | 542 | Open in IMG/M |
3300032211|Ga0310896_10684933 | Not Available | 579 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.01% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.11% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.11% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.41% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.41% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.60% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.70% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.70% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.70% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.80% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.90% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_00357330 | 2199352025 | Soil | VKVFLLIVGILVATAGGVTTYRALYVEPRSAVVITETEVRELPNYTRVVGAP |
INPhiseqgaiiFebDRAFT_1043048561 | 3300000364 | Soil | MKALFLILGVLIATAGGVITYRALYLEPKSAVVVTETGIR |
LJQas_10257432 | 3300000549 | Quercus Rhizosphere | MKALLLIIGILAATAGGVITYRELYVEQKSAVIITETDIRQLPNYTRVVGGA |
JGI12627J18819_100540961 | 3300001867 | Forest Soil | MKALLLIVGIMVATAGGVITYRALYVEPKSAVVISDSGIRQIPDQARVVGGALL |
Ga0062593_1023485892 | 3300004114 | Soil | VKVLLLIIGIIVATAGGVMTYRTLYVEPKSAVVVTETGIRQIPNQARVVGG |
Ga0062589_1018736481 | 3300004156 | Soil | MKALFLIVGMLVATAGGVITYRALYLEPKSAVIKADTGDIKEIPNYTRV |
Ga0062591_1011967391 | 3300004643 | Soil | MLIVGILVATAGGVITYRALYVEPKSGVVVTDSGIREIPNQARVVGGAL |
Ga0065715_104797911 | 3300005293 | Miscanthus Rhizosphere | LKALLLIVGILIATAGGVICYRALYVEPKSGVVITDTGIRQIPNQARVVGGA |
Ga0065707_102831511 | 3300005295 | Switchgrass Rhizosphere | MKSLLLIVGILIATAGGVITYRALYVEPKSGVVITDSGIRQIPDQARVVGGALMFV |
Ga0070690_1015937922 | 3300005330 | Switchgrass Rhizosphere | MKVLLLIVGILLATVGGVITYRALYVEPRSAVVITDTEIREL |
Ga0068869_1002687273 | 3300005334 | Miscanthus Rhizosphere | LKALLLILGVLIATAGGVITYRALYVEPKSGVVITDTGIR |
Ga0070688_1007194181 | 3300005365 | Switchgrass Rhizosphere | VKVLLLIVGIIVATAGGVITYRTLYVEPKSAVVISETGSIRQIPNQARV |
Ga0070705_1003584882 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIVGILVATAGGVITYRALYVEPKSELVITETEIRQIPNQARVVGGALMF |
Ga0070700_1018408321 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALLLIVGIILATIGGVITYRALYVEPKSAVIITDTDVRQLPNYTRVVGGALLFVG |
Ga0070678_1016827922 | 3300005456 | Miscanthus Rhizosphere | MKALLLIVGILIATAGGVITYRALYVEPKSAVVITESEVRELPNYTRVISG |
Ga0070681_113001291 | 3300005458 | Corn Rhizosphere | VKVLLLIVGILVATVGGVITYRTLYVEPKSAVVITETGIRQIPNQARVVGG |
Ga0070699_1015839861 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLLLIVGILIATAGGVITYRALYVEPKSGVVITDSGIR |
Ga0070695_1002004573 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVFLLIVGILVATAGGVTTYRALYVEPRSAVIITESEVRELPNYKRVV |
Ga0070695_1004659522 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTVLLIVGILLATAGGVITYRALYVEPKSAVVITESEVRELPNYTRVIGGAL |
Ga0070695_1012913122 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTLLLIVGVLIATAGGVITYRALYVEPKSGVVITDTGIRQIPN |
Ga0070696_1007579932 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALLLIVGILIATAGGVICYRALYVEPKSGVVITDTGIRQ |
Ga0070696_1012201101 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVLLLIVGIILATAGGVMTYRTLYVEPKSAVVITETGIRQIPN |
Ga0070693_1016403191 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LKVFLLIVGILVATAGGVTTYRALYVEPRTSFVVSDRGIRELPNYKRVVGGALMLV |
Ga0070664_1006251432 | 3300005564 | Corn Rhizosphere | VKALLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPD |
Ga0068859_1008118733 | 3300005617 | Switchgrass Rhizosphere | VKALLLILGILIATAGGVITYRTLYVEPKSGVVITD |
Ga0068859_1013060622 | 3300005617 | Switchgrass Rhizosphere | MKTILLIVGILVATAGGVITYRALYTEPKSAVVITDTGDVRELPNYARVVT |
Ga0068859_1023139681 | 3300005617 | Switchgrass Rhizosphere | MRALMLIVGILVATAGGVITYRALYVEPKSAVVITETEIRQIPNQARVVGGALM |
Ga0066905_1020555122 | 3300005713 | Tropical Forest Soil | MRVFLLIVGILVATAGGVITYRALYLEPKSTVVITESEIKTLPNQARVVGGA |
Ga0068861_1026916142 | 3300005719 | Switchgrass Rhizosphere | MKTLLLFIGVLVATAGGVITYRALYIEPKSAVVITETGIRE |
Ga0068870_104005952 | 3300005840 | Miscanthus Rhizosphere | MKALLLIVGILIATAGGVITYRALYVEPKSAVVITE |
Ga0068870_104659271 | 3300005840 | Miscanthus Rhizosphere | VKALLLIVGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPDQAR |
Ga0068870_109427001 | 3300005840 | Miscanthus Rhizosphere | MKAVLLIIGVLLATAGGVITYRALYIEPKSAVVITE |
Ga0068863_1005501413 | 3300005841 | Switchgrass Rhizosphere | VKALLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPDQ |
Ga0075291_10141112 | 3300005884 | Rice Paddy Soil | VKALLLIVGVLIATAGGVITYRALYVEPKSAVVITDTGIRQIPNQAR |
Ga0075290_10303242 | 3300005889 | Rice Paddy Soil | VKALLLIVGVLIATAGGVITYRALYLEPKSAVVITETGIRQI |
Ga0075422_104703322 | 3300006196 | Populus Rhizosphere | MKAVLLIIGVLLATAGGVITYRALYVEPKSAVVITESEVREL |
Ga0068871_1011134192 | 3300006358 | Miscanthus Rhizosphere | VKVFLLIVGILVATAGGVTTYRALYVEPRSAVVITETEV |
Ga0075431_1021166171 | 3300006847 | Populus Rhizosphere | MRSILLIVGILIATAGGVITYRALYVEPKSAVVITETEVRELPNQA |
Ga0075433_106172252 | 3300006852 | Populus Rhizosphere | VKVLLLIVGIIVATAGGVITYRTLYIEPKSAVVISDTGSIRQIPNQARVV |
Ga0075433_111015212 | 3300006852 | Populus Rhizosphere | MRVFLLIIGILVATAGGVITYRALYVEPKSTVVITDSEIKTLP |
Ga0075433_115970411 | 3300006852 | Populus Rhizosphere | LKVFLLIVGILVATAGGVTTYRALYVEPRTSVVISETGVRELPNYKRVVGGALMLVC |
Ga0075429_1005481951 | 3300006880 | Populus Rhizosphere | MKVLLLIVGILIATAGGVITYRALYVEPKSAVVISESGIRQIPDQAR |
Ga0079215_111673861 | 3300006894 | Agricultural Soil | LFCSVPMKVLLLIVGLLLATVGGVITYRALYMEPRSAVVITETE |
Ga0079219_103240052 | 3300006954 | Agricultural Soil | VKALLLIVGVLVATAGGVITYRALYVEPKSGVVITDTGVRQIPNQARVVGG |
Ga0079218_100092211 | 3300007004 | Agricultural Soil | MKALLLIVGIMLATIGGVITYRALYVEPKSAVVITETEIRQLPNYARVVGG |
Ga0079218_121477511 | 3300007004 | Agricultural Soil | MKTLLLIVGILLATAGGVITYRALYVEPRSAVIITE |
Ga0105245_106685791 | 3300009098 | Miscanthus Rhizosphere | MATLRIFVLLAGILVATAGGVTLYRSLYVEPRSAVVIT |
Ga0075418_123442831 | 3300009100 | Populus Rhizosphere | MKSLLLIVGILVATAGGVITYRALYVEPKSGVVITD |
Ga0111538_129408961 | 3300009156 | Populus Rhizosphere | VKVLLLIVGIIVATAGGVITYRALYLEPKSAVISETGSIRQIPN |
Ga0075423_105742071 | 3300009162 | Populus Rhizosphere | VRALLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPDQARV |
Ga0105241_123638521 | 3300009174 | Corn Rhizosphere | VKALLLIVGVLIATAGGVITYRALYVEPKSGVVVTDTGIRQIPNQARVVGGALLFVS |
Ga0105248_112350411 | 3300009177 | Switchgrass Rhizosphere | MKTLLLFIGVLVATAGGVITYRALYIEPRSAVVITETG |
Ga0126307_112163742 | 3300009789 | Serpentine Soil | VKALLLIVGILVATAGGVITYRALYVEPKSGVVITETDIRLIPNQARVVGG |
Ga0126315_107285651 | 3300010038 | Serpentine Soil | VKVLLLIVGILVATAGGVITYRALYLEPKSAVVITETDIRQIPNQARVV |
Ga0126315_112611601 | 3300010038 | Serpentine Soil | VKALLLIVGILLATVGGVITYRALYMEPRSAVVITDTDIRDLPNYTRVVGGA |
Ga0126312_111613381 | 3300010041 | Serpentine Soil | MRTILLIAGLLVATTGGVITYRALYVEPKSTVVITDGDVRELPNYTRVI |
Ga0126311_100025929 | 3300010045 | Serpentine Soil | LKALLLIVGILIATAGGVITYRALYLEPKSGVVITDTGTRQ |
Ga0126311_100238225 | 3300010045 | Serpentine Soil | VKALLLIVGILVATAGGVITYRALYVEPKSGVVITETDIRLIPNQARVVG |
Ga0126311_109429011 | 3300010045 | Serpentine Soil | VKALLLIVGVLIATAGGVITYRALYVEPKSGVVITDTGIRQIPNQARVVGGALLF |
Ga0126382_113500331 | 3300010047 | Tropical Forest Soil | VKTLLLIVGVLVATVGGVITYRTLYVEPKSAVVISDTGSIRQI |
Ga0126306_102872011 | 3300010166 | Serpentine Soil | LKALLLIVGVLIATAGGVITYRALYVEPKSGVVITETGIRQIPNQARLV |
Ga0126306_111738062 | 3300010166 | Serpentine Soil | MKALLLIIGILLATAGGVITYRALYVEPKSAVVITETEIRQLPNQARVIG |
Ga0134128_113595141 | 3300010373 | Terrestrial Soil | VKALLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQ |
Ga0105239_120191561 | 3300010375 | Corn Rhizosphere | VKVLLLIVGIIVATAGGVITYRTLYIEPKAAVVISDTGSIRQIPNQARVVGGALLFVG |
Ga0134124_130841971 | 3300010397 | Terrestrial Soil | MKALLLIVGILIATAGGVICYRALYVEPKSCVVITDTGIRQIPNQARVVGGAL |
Ga0134121_118151871 | 3300010401 | Terrestrial Soil | VKVLLLIVGLIVATAGGVITYRTLYVEPKSAVVITETGIRQIPNQARVVGGA |
Ga0134123_109969321 | 3300010403 | Terrestrial Soil | MKALLLIVGILIATAGGVITYRALYVEPKSAVVITESEVRELPNYTRVISGALLF |
Ga0134123_120277391 | 3300010403 | Terrestrial Soil | MKALFLILGVLIATAGGVITYRALYLEPKSAVVVTETGIRQIPDQ |
Ga0134123_121069162 | 3300010403 | Terrestrial Soil | MKTLLLIVGILIATAGGVITYRALYVEPRSAVVITESE |
Ga0137392_103129192 | 3300011269 | Vadose Zone Soil | MKTILLIAGILLATAGGVITYRAIYSDPRSAVVISDTGVREVPNY |
Ga0137362_109918781 | 3300012205 | Vadose Zone Soil | MKVILLIAGILLATAGGVITYRAIYSDLRSAVVISDTG |
Ga0137378_118061621 | 3300012210 | Vadose Zone Soil | LKTILLIAGIILATAGGVITYRAIYLEPSSAVVITES |
Ga0164300_108691872 | 3300012951 | Soil | VKVLLLIVGIIVATAGGVITYRTLYVEPKSAVVISETTGSIRQIPNQAR |
Ga0164303_107173182 | 3300012957 | Soil | MKALLLIVGILVATAGGVITYRALYVEPKSGVVITDSGIRQIP |
Ga0164301_107394201 | 3300012960 | Soil | VKVFLLIVGILVATAGGVTTYRALYVEPRSAVVITETEVRELPNYKRVVGGALMLV |
Ga0164301_112230782 | 3300012960 | Soil | VKALLLIVGVLIATAGGVITYRALYVEPKSGVVITDNGIRQIPNQARLVGGA |
Ga0157374_105018831 | 3300013296 | Miscanthus Rhizosphere | MKTFILIIGILVATAGGVTTYRALYIEPRSAVVISDSGVR |
Ga0163162_104412593 | 3300013306 | Switchgrass Rhizosphere | VKTLLLIVGILVATVGGVVTYRALYVEPKSGVVITDAGIRQIPNQA |
Ga0163162_134037391 | 3300013306 | Switchgrass Rhizosphere | MKTILLIVGILVATAGGVITYRALYTEPKSAVVITDTGDVRELPNYARVVTGALLF |
Ga0157375_101096984 | 3300013308 | Miscanthus Rhizosphere | VKVFLLIVGILVATAGGVTTYRALYVEPRSAVVITETEVRELPNYKRVVGGALMLVCG |
Ga0157375_124788961 | 3300013308 | Miscanthus Rhizosphere | LKALLLIVGILVATAGGVITYRALYVEPKSGVVITDTGIRQIPNQARVVGGA |
Ga0157375_136339742 | 3300013308 | Miscanthus Rhizosphere | LKIFVLIVGILVATVGGVTTYRALYVEPRSSFVVSDSGVRSLPNYKHVIGGA |
Ga0157377_109245261 | 3300014745 | Miscanthus Rhizosphere | MKALLLIVGILIATAGGVITYRALYVEPKSAVVIT |
Ga0157379_106714331 | 3300014968 | Switchgrass Rhizosphere | MRALMLIVGILVATAGGVITYRALYVEPKSAVVITETEIRQIPNQ |
Ga0157379_121233301 | 3300014968 | Switchgrass Rhizosphere | VKALLLIVGVLIATAGGVITYRALYVEPKSGVVITDYGIRQIPNQ |
Ga0132258_1000330930 | 3300015371 | Arabidopsis Rhizosphere | MKALLLILGILGATAGGVITYRALYVEPKSGVVITETEIRQIPNQARVVGGALMF |
Ga0132258_130098713 | 3300015371 | Arabidopsis Rhizosphere | MKTLLLIVGMLVATAGGVITYRALYLEPKSAVINADTGDVKEIPNYTRVIGG |
Ga0184605_105143982 | 3300018027 | Groundwater Sediment | LRAILVVLGILLATAGGVITYRALYLDPSSAVVITESQVREVPNYA |
Ga0184608_104740762 | 3300018028 | Groundwater Sediment | MKIILLVVGILLATAGGVITYRALYLDPKSGVVITESQVR |
Ga0182009_100898903 | 3300021445 | Soil | VKVLMLIVGMLVATAGGVITYRTLYVEPKSAVVITETGIRQIPN |
Ga0207645_108707012 | 3300025907 | Miscanthus Rhizosphere | VKALLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPDQA |
Ga0207662_110351181 | 3300025918 | Switchgrass Rhizosphere | LKALLLIVGILVATAGGVITYRALYVEPKSGVVITD |
Ga0207659_111296461 | 3300025926 | Miscanthus Rhizosphere | MKAVLLIIGVLLATAGGVITYRALYIEPKSAVVITESEVRELPNYTRVIGGA |
Ga0207701_108236082 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVLLLIVGMMIATAGGVITYRTLYVEPKSAVVITETGIRQIPNQ |
Ga0207686_116337562 | 3300025934 | Miscanthus Rhizosphere | VKTLLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPDQARVVGGALMFV |
Ga0207709_108743372 | 3300025935 | Miscanthus Rhizosphere | LKALLLIVGVLIATAGGVITYRALYVEPKSGVVITDTGIRQIPNQARVVGGALL |
Ga0207709_109725691 | 3300025935 | Miscanthus Rhizosphere | LKVFLLIVGILVATAGGVTTYRALYVEPRTSYVVSETGVR |
Ga0207669_117202261 | 3300025937 | Miscanthus Rhizosphere | LKALLLIVGILVATAGGVITYRALYVEPKSGVVITDTGIRQIPNQARVVGGALLF |
Ga0207689_111088072 | 3300025942 | Miscanthus Rhizosphere | VKTLLLIVGILVATAGGVITYRALYVEPKSGVVIT |
Ga0207651_112861551 | 3300025960 | Switchgrass Rhizosphere | LKALLLIIGILVATAGGVITYRALYVEPKSGVVITDTGIRQIPNQA |
Ga0207651_115694341 | 3300025960 | Switchgrass Rhizosphere | VKALLLILGILIATAGGVITYRTLYVEPKSGVVITDSGIRQIPDQARVVGGALMFVG |
Ga0207651_115924131 | 3300025960 | Switchgrass Rhizosphere | VKVFLLIVGILVATAGGVTTYRALYVEPRSAVVITETEVRELPNYKRVVGG |
Ga0207651_115994852 | 3300025960 | Switchgrass Rhizosphere | MKALLLIVGILIATAGGVITYRALYVEPKSAVVITESEVRELPNYTR |
Ga0207651_121186952 | 3300025960 | Switchgrass Rhizosphere | VKALLLIVGVLIATAGGVITYRALYLEPKSGVVITD |
Ga0207639_112833212 | 3300026041 | Corn Rhizosphere | MKSLLLIVGILAATAGGVITYRALYVEPKSGVVISDSGIRQI |
Ga0207675_1024717141 | 3300026118 | Switchgrass Rhizosphere | LKALLLIVGVLIATAGGVICYRALYVEPKSGVVITDTGIRQIPNQARV |
Ga0207683_104707791 | 3300026121 | Miscanthus Rhizosphere | MKALLLIVGILIATAGGVITYRALYVEPKSAVVITESEVRELPNYTRVISGA |
Ga0209387_10152461 | 3300027639 | Agricultural Soil | MKALLLIVGIMLATIGGVITYRALYVEPKSAVVITET |
Ga0207428_101047625 | 3300027907 | Populus Rhizosphere | MKAVLLIIGVLLATAGGVITYRALYVEPKSAVVITESEVRE |
Ga0307414_119942312 | 3300032004 | Rhizosphere | MKTLLLIVGILVATAGGVITYRALYVEPKTAVIITET |
Ga0310896_106849331 | 3300032211 | Soil | MKALFLILGVLIATAGGVITYRALYLEPKSAVVVTETGIRQIPDQARVVGG |
⦗Top⦘ |