NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085785

Metagenome / Metatranscriptome Family F085785

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085785
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 82 residues
Representative Sequence MNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHK
Number of Associated Samples 104
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.20 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.180 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.514 % of family members)
Environment Ontology (ENVO) Unclassified
(22.523 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(27.027 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 51.43%    β-sheet: 0.00%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF06082YjbH 13.51
PF00356LacI 0.90
PF12704MacB_PCD 0.90



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.18 %
UnclassifiedrootN/A19.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2251012All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium849Open in IMG/M
3300001809|JGI20220J20339_1031279All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium566Open in IMG/M
3300003569|Ga0007420J51693_1040271Not Available563Open in IMG/M
3300003570|Ga0007418J51697_1029568All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium612Open in IMG/M
3300004463|Ga0063356_104326655All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium611Open in IMG/M
3300004798|Ga0058859_10076785All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium603Open in IMG/M
3300004798|Ga0058859_10122338Not Available542Open in IMG/M
3300004801|Ga0058860_12205782Not Available656Open in IMG/M
3300005169|Ga0066810_10076840All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium701Open in IMG/M
3300005332|Ga0066388_104603595All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium702Open in IMG/M
3300005338|Ga0068868_100898165All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium805Open in IMG/M
3300005343|Ga0070687_101405322Not Available522Open in IMG/M
3300005447|Ga0066689_10676950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium647Open in IMG/M
3300005536|Ga0070697_100920736All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium776Open in IMG/M
3300005549|Ga0070704_100483455All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1072Open in IMG/M
3300005555|Ga0066692_10587049All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium701Open in IMG/M
3300005556|Ga0066707_11034027Not Available500Open in IMG/M
3300005713|Ga0066905_100972735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium747Open in IMG/M
3300005829|Ga0074479_10310858All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium563Open in IMG/M
3300005836|Ga0074470_11442887All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1237Open in IMG/M
3300006355|Ga0075501_1340592All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium609Open in IMG/M
3300006796|Ga0066665_10804048All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium741Open in IMG/M
3300006797|Ga0066659_10921469All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium730Open in IMG/M
3300006903|Ga0075426_11537938All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium506Open in IMG/M
3300009176|Ga0105242_11543914Not Available696Open in IMG/M
3300009257|Ga0103869_10120175Not Available672Open in IMG/M
3300009808|Ga0105071_1083340Not Available561Open in IMG/M
3300010080|Ga0127448_134460All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium537Open in IMG/M
3300010102|Ga0127453_1079067All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium533Open in IMG/M
3300010125|Ga0127443_1111611All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium588Open in IMG/M
3300010147|Ga0126319_1409474All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium598Open in IMG/M
3300010320|Ga0134109_10483553Not Available508Open in IMG/M
3300010857|Ga0126354_1267226All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium602Open in IMG/M
3300010861|Ga0126349_1087211All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium530Open in IMG/M
3300010895|Ga0138113_171097All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium562Open in IMG/M
3300011333|Ga0127502_10713344All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium616Open in IMG/M
3300012198|Ga0137364_11107206All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium596Open in IMG/M
3300012203|Ga0137399_11266588All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium621Open in IMG/M
3300012206|Ga0137380_10614003All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium950Open in IMG/M
3300012207|Ga0137381_10987156All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium726Open in IMG/M
3300012209|Ga0137379_11750697All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium517Open in IMG/M
3300012212|Ga0150985_121371543All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium502Open in IMG/M
3300012349|Ga0137387_11167941All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium545Open in IMG/M
3300012356|Ga0137371_10837678All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium700Open in IMG/M
3300012379|Ga0134058_1093990Not Available515Open in IMG/M
3300012385|Ga0134023_1078858All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium525Open in IMG/M
3300012386|Ga0134046_1064619All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium549Open in IMG/M
3300012388|Ga0134031_1304291All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium522Open in IMG/M
3300012396|Ga0134057_1130090All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium512Open in IMG/M
3300012402|Ga0134059_1388377Not Available541Open in IMG/M
3300012407|Ga0134050_1089425All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium568Open in IMG/M
3300012977|Ga0134087_10579352All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium578Open in IMG/M
3300014269|Ga0075302_1178367All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium531Open in IMG/M
3300015372|Ga0132256_103198498All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium551Open in IMG/M
3300018029|Ga0187787_10388987All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium547Open in IMG/M
3300018064|Ga0187773_10500287All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium725Open in IMG/M
3300019228|Ga0180119_1132204All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1183Open in IMG/M
3300019228|Ga0180119_1242163All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium588Open in IMG/M
3300019232|Ga0180114_1337378All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium606Open in IMG/M
3300019238|Ga0180112_1321376Not Available825Open in IMG/M
3300019249|Ga0184648_1331548All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium512Open in IMG/M
3300019257|Ga0180115_1339932All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1262Open in IMG/M
3300019269|Ga0184644_1056834All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium538Open in IMG/M
3300019269|Ga0184644_1640626Not Available508Open in IMG/M
3300019279|Ga0184642_1324191All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium519Open in IMG/M
3300019886|Ga0193727_1098317All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium866Open in IMG/M
3300021269|Ga0210356_120219All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium500Open in IMG/M
3300021951|Ga0222624_1138612All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium564Open in IMG/M
3300021951|Ga0222624_1325776All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium548Open in IMG/M
3300021951|Ga0222624_1581775Not Available530Open in IMG/M
3300022156|Ga0213934_1054610All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium560Open in IMG/M
3300022195|Ga0222625_1158367Not Available544Open in IMG/M
3300025931|Ga0207644_11593610All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium548Open in IMG/M
3300026023|Ga0207677_10938896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium782Open in IMG/M
3300026088|Ga0207641_12525963Not Available512Open in IMG/M
3300026095|Ga0207676_10535709All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1117Open in IMG/M
3300026118|Ga0207675_100999306All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium855Open in IMG/M
3300026332|Ga0209803_1226471All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium658Open in IMG/M
3300027187|Ga0209869_1047404All Organisms → cellular organisms → Bacteria → Proteobacteria506Open in IMG/M
3300027907|Ga0207428_11048520Not Available571Open in IMG/M
3300027910|Ga0209583_10554677Not Available577Open in IMG/M
3300030546|Ga0247646_1231929All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium544Open in IMG/M
3300030576|Ga0247644_1147006All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium570Open in IMG/M
3300030614|Ga0247657_10271289All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium524Open in IMG/M
3300030682|Ga0247622_1159925All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium549Open in IMG/M
3300030831|Ga0308152_115269All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium513Open in IMG/M
3300030988|Ga0308183_1137918All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium590Open in IMG/M
3300030990|Ga0308178_1156241All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium528Open in IMG/M
3300030994|Ga0308153_113847Not Available534Open in IMG/M
3300031081|Ga0308185_1034234All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium622Open in IMG/M
3300031093|Ga0308197_10271494All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium612Open in IMG/M
3300031093|Ga0308197_10293787All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium596Open in IMG/M
3300031096|Ga0308193_1054762All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium607Open in IMG/M
3300031114|Ga0308187_10296629All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium605Open in IMG/M
3300031114|Ga0308187_10454104All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium518Open in IMG/M
3300031421|Ga0308194_10256125All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium589Open in IMG/M
3300031423|Ga0308177_1023957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium556Open in IMG/M
3300031820|Ga0307473_11334424All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium538Open in IMG/M
3300032143|Ga0315292_10762037All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium812Open in IMG/M
3300032156|Ga0315295_10578134All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1139Open in IMG/M
3300032177|Ga0315276_11283083All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium769Open in IMG/M
3300032205|Ga0307472_101484055All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium661Open in IMG/M
3300033513|Ga0316628_102218738All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium728Open in IMG/M
3300034480|Ga0314789_030459Not Available525Open in IMG/M
3300034643|Ga0370545_115896All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium596Open in IMG/M
3300034644|Ga0370548_137088All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium521Open in IMG/M
3300034661|Ga0314782_060539Not Available778Open in IMG/M
3300034665|Ga0314787_101458Not Available535Open in IMG/M
3300034667|Ga0314792_182028All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium580Open in IMG/M
3300034670|Ga0314795_080480All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium626Open in IMG/M
3300034674|Ga0314799_020556All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium700Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.51%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment11.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil11.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.60%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.70%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.70%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.70%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.80%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.80%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.80%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.80%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.90%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.90%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.90%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.90%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.90%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001809Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003569Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_36 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003570Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009257Microbial communities of water from Amazon river, Brazil - RCM22EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300010080Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010102Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010125Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010857Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010895Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012379Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012396Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300021269Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022156Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027187Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030576Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030682Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030831Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030994Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_142 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031423Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034480Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034665Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034670Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034674Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_225101213300000033SoilMHIDHRNPRVRRGFAFVALAALLGLTVVGLSQCRMVDDTVTGVDLQANQGVNARSDCVHACNDQFKACKRAEDARHKQAQRDCGS
JGI20220J20339_103127923300001809WetlandMNIDHRNPRLRRGFAFVALAAVLGLAAVGLTQCRAVNDTVTGVDLSNSSGDLHARMSCTKKCNDQFKSCIRAAEAKYKTAKKNCHWNWWCLKAAQ
Ga0007420J51693_104027123300003569Avena Fatua RhizosphereMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHKQAQRDCGSDKACKK
Ga0007418J51697_102956823300003570Avena Fatua RhizosphereMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVNDNVTGVDLRSGNGQLSAKSACVKACNEQAKQCKKDEDARHKAAKKACMSDNACKKAEDQLHK
Ga0063356_10432665513300004463Arabidopsis Thaliana RhizosphereMHIDHRNPRVRRGFAFVALAAVLGLTAVGLTQCRMTNDTVTGVDLNAASGLSARSDCVRSCNDSFKACLRAEQARHKAAKA
Ga0058859_1007678523300004798Host-AssociatedMNTDHRNPRLRRGFAFVALAALLGLSAVSLTQCRMVNDSVTGVDLKANTTASAKSNCVRQCNEKRKACQKAEDARHKEAKKACLSDKACKKAED
Ga0058859_1012233813300004798Host-AssociatedMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHKQAQRD
Ga0058860_1220578223300004801Host-AssociatedMSLDHRTPRIRRGIAFIALASLLGVSALVLTQCRMVNDNVTGVDLKANTTASAKSNCVRQCNEKRKACQKAEDARHKEAKKACLSDKAC
Ga0066810_1007684023300005169SoilMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHK
Ga0066388_10460359523300005332Tropical Forest SoilMNIDHRNPRLRRGFAFVALAAVLGLSALGLTQCRMVGDSVTGVDVKSATGLNAISDCMHRCNDAYKACRKAEDARHKQALRDCRALPHPDDQAC
Ga0068868_10089816523300005338Miscanthus RhizosphereMNIDHRNPRLRRGFAFVALAALLGLAAVGLSQCRMVNDTVTGVDLKANSTVSARSDCVKQ
Ga0070687_10140532213300005343Switchgrass RhizosphereMNIDHRNPRLRRGFAFVALAALLGLSVIGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHKQAQRDCGSDKACK
Ga0066689_1067695023300005447SoilMNFDHRNPRLRRGFAFVALAAVLGLSAVGLSQCRLVDDSVTGVDLRSNSTAFSSARSKCVHQCNEKYKQCKKAEEALHKANKKACGSHDSAC
Ga0070697_10092073613300005536Corn, Switchgrass And Miscanthus RhizosphereMHIDHRNPRVRRGFAFVALAAVLGLTAVGITQCRMVNDNVTGVDLRAGVGTLSGRSSCVRHCNDLFKACLRNEESRH
Ga0070704_10048345523300005549Corn, Switchgrass And Miscanthus RhizosphereMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLQSASGLNARSGCVHGCNDAFKSCL
Ga0066692_1058704923300005555SoilMNIDHRNPRLRRGFAFVALAAVLGLSAVGLSQCRLVDDSVTGVDLRSNSTAFSSARSKCVHQCNEKYKQCKKAEEA
Ga0066707_1103402713300005556SoilMNIDHRNPRLRRGFAFVALAAVLGLSAVGLSQCRLVDDSVTGVDLRSNSTAFSSARSKCVHQCNEKYKQCKKAEEALHKANKKACGSHDSAC
Ga0066905_10097273513300005713Tropical Forest SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVDDNVTGVDLRSGAGLNARSACVHQCNDKFKACDRAELSRYK
Ga0074479_1031085813300005829Sediment (Intertidal)MHIDHRNPRVRRGFAFVALAAVLGLTAVGLTQCRMVNDNVTGVDLRAGNGQLSHRSSCARHCNDLFKAC
Ga0074470_1144288713300005836Sediment (Intertidal)MYIDHRNPRLRRGFAFVALAAILGLCAVGLTQCRLVDDTVTGVDLKSNTGLNARSTCVRQCNEKNKQCKRDEEA
Ga0075501_134059213300006355AqueousMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLTANSGVNARSDCVHACNETYKACKRAEDSRHKAAQRACGSDKACKKAEKML
Ga0066665_1080404813300006796SoilMNIDHRNPRLRRGFAFVALAALLGLSVFALTQCRMVNDTVTGVDLKANQTVSARSDCVHQCNEQYKACKKAESARHKAAERACHSDKV
Ga0066659_1092146923300006797SoilMNIDHRNPRLRRGFAFVALAALLGLSIVALSQCRMVNDTVTGVDVKSNQTVSARNDCVHQCNEQYKACKKAESARHKAAQRACHSDKACKKNEQTLHKTLAG
Ga0075426_1153793813300006903Populus RhizosphereMHIDHRNPRVRRGFAFVALAAVLGLTAVGITQCRMVNDNVTGVDLRAGVGTLSGRSSCVRHCNDLFKAC
Ga0105242_1154391413300009176Miscanthus RhizosphereMSLDHRTPRIRRGIAFIALASLLGVSALVLTQCRMVNDNVTGVDLKANSTASAKSACTR
Ga0103869_1012017523300009257River WaterMNIDHRNPRLRRGFAFVALAAVLGLSAVGLTQCRMVDDTVTGVDVRSNTGFSSGRSACVHQCNEKYKACKRAEDARHKAAIRACGSHNS
Ga0105071_108334013300009808Groundwater SandMNIDHRNPRLRRGFAFVALAAVLGLSAVGLTQCRLVDDTVTGVDVKSNSGFSGGRSACEKACNE
Ga0127448_13446013300010080Grasslands SoilMNIDHRNSRLRRGFAFVALAALLGLSVVGLSQCRLVNDTVTGVDLTANSGTNARSDCVHRCNEQYKSCRRAEDA
Ga0127453_107906713300010102Grasslands SoilMNIDHRNPRVRRGFAFVALAAVLGLTAVGLSQCRLVGDTVTGVDLRSNPGLNARSDCVHQCNEKYKACRRGEEARHK
Ga0127443_111161123300010125Grasslands SoilMNIDHRNPRVRRGFAFVALAAVLGLTAVGLSQCRLVGDTVTGVDLRSNPGLNARSDCVHQCNEKYKACRRGEEARHKSTLRTCGNDN
Ga0126319_140947423300010147SoilMNTDHRNPRLRRGFAFVALAALLGLSAVSLTQCRMVNDSVTGVDLKANATASAKSNCVRQCNEKRKACQKAEDARHKEAKKACLSDKACKK
Ga0134109_1048355313300010320Grasslands SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMVNDNVTGVDLRSGNGTLSARSACVKACNEQFKECKRNEEVRHKAAKKACGSDSACK
Ga0126354_126722623300010857Boreal Forest SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLQSASGLNARSGCVRGCNDAFKSCLRNEQARHKAAKAACGHDNACKKAEQRLNN
Ga0126349_108721113300010861Boreal Forest SoilMHIDHRNPRVRRGFAFVALAAVLGLTAVGLTQCRMVNDNVTGVDLRSGNGTLSARSSCVKQCNEKFKACQKS
Ga0138113_17109713300010895Grasslands SoilMNIDHRNPRLRRGFAFVALAALLGLAVVGLSQCRMVDDTVTGVNLNAASGTNARSDCVHRCNEAYKACHRAEDARHKAA
Ga0127502_1071334423300011333SoilMNFDHRNPRVRRGFAFVALAALLGLSVVGLSQCRLVDDTVTGVDLQANNGVNARSDCVHQCNEKYKACKRAEDARHKQAKRDCGSDKACKKAEQRLHK
Ga0137364_1110720623300012198Vadose Zone SoilMNIDHRNPRVRRGFAFVALAAVLGLTAVGLSQCRLVGDTVTGVDLRSNPGLNARSDCVHQCNEKYKACRRGEEARHKSTLRTCGNDNSC
Ga0137399_1126658823300012203Vadose Zone SoilMHIDHRNPRVRRGFAFVALAAVLGLSAVGLTQCRMVNDNVTGVDLRAGAGQLSGRSSCARKCNESFKACLRAEEARHKSA
Ga0137380_1061400313300012206Vadose Zone SoilMNIDHRNPRLRRGFAFVALAALLGLAVVGLSQCRMVDDTVTGVNLNAASGTNARSDCFHRCNEQYKACHRAEDARHKAAQRACGSDKSCKKNEQ
Ga0137381_1098715613300012207Vadose Zone SoilMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVNDTVTGVDLTANSGTNARSDCVHRCNEQYKACRRAED
Ga0137379_1175069723300012209Vadose Zone SoilMNIDHRNPRLRRGFAFVALAALLGLAVVGLSQCRMVDDTVTGVNLNAASGTNARSDCVHRCNEAYKAC
Ga0150985_12137154323300012212Avena Fatua RhizosphereMHFNHRTPRVRRGFTFALAAVLGLAAVGITQCRMVNDNVTGVDLRAGSGSLSGRSSCVHACND
Ga0137387_1116794113300012349Vadose Zone SoilMNIDHRNPRLRRGFAFVALAALLGLAVVGLSQCRMVDDTVTGVNLNAASGTNARSDCVHRCNEAYK
Ga0137371_1083767813300012356Vadose Zone SoilMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVNDTVTGVDLTANSGTNARSDCVHRCNEQYKACRR
Ga0134058_109399023300012379Grasslands SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMVNDNVTGVDLRSGNGTLSARSACVKACNEQFKECKRNEEVRHKAAKKACGSDSACKKAEELTHH
Ga0134023_107885813300012385Grasslands SoilMNIDHRNPRLRRGFAFVALAALLGLSAVSLTQCRMVNDSVTGVDLKANATASAKSNCVRQCNEKRKACQK
Ga0134046_106461923300012386Grasslands SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMVNDNVTGVDLRSGNGTLSARSACVKACNEQFKECKRAEELR
Ga0134031_130429123300012388Grasslands SoilMNTDHRNPRLRRGFAFVALAALLGLSAVSLTQCRMVNDSVTGVDLKANATASAKSNCVRQCNEKRKACQKAED
Ga0134057_113009013300012396Grasslands SoilMNIDHRNPRLRRGFAFVALAALLGLAIVGLSQCRMVDDTVTGVNLNAASGTNARSDCVHRCNEAYK
Ga0134059_138837723300012402Grasslands SoilMNIDHRNPRLRRGFAFVALAALLGLAVVGLSQCRMVDDTVTGVNLNAASGTNARSDCVHRCNEAYKACHRAEDARHKAAQRNCGTDKACKKAE
Ga0134050_108942523300012407Grasslands SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGITQCRMVNDNVTGVDLRAGAGTLSGRSSCVHRCNDAYKACLRAEEARYKAAKRACGD
Ga0134087_1057935213300012977Grasslands SoilMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVDDTVTGVDLTANSGTNARSDCVHRCNEQYKACHRAEDARHKAA
Ga0075302_117836713300014269Natural And Restored WetlandsMNFDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVDDSVTGVVLQDESSVHGRNSCVHECIKDFKAC
Ga0132256_10319849823300015372Arabidopsis RhizosphereMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVNDNVTGVDLRSGGPLSAKSACVKACNEQAKQCKKDEDARHKAAKKACGSHDNACKK
Ga0187787_1038898713300018029Tropical PeatlandMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVNDNVSGVDLRSGNGQLSARSSCEQHCNDLFKACIRANE
Ga0187773_1050028723300018064Tropical PeatlandMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVNDNVSGVDLRSGNGQLSARSACEQHCNDLFKACVRANESSFKACKRACGHDNACKKACN
Ga0180119_113220413300019228Groundwater SedimentMSLDHRTPRIRRGIGFIALASLLGVSALVLTQCRMVNDNVTGVDLKANATASAKSNCVKQCNEKRKACQKAENTRHKEAKKACLSDKACKKAEDA
Ga0180119_124216313300019228Groundwater SedimentMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVDDTVTGVELQANSGVNARSDCVHQCNDKYKACKRAEDARHKQAQRDCGSDKA
Ga0180114_133737813300019232Groundwater SedimentMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLSAASGLGARSTCVRQCNDSFKSCLRAEQARHKAAKAACGHDNACKKAVQRLHY
Ga0180112_132137623300019238Groundwater SedimentMSLDHRTPRIRRGIGFIALASLLGVSALVLTQCRMVNDNVTGVDLKANATASAKSNCVRQCNEKRKACQKAEDARHKEAKKACLSDKACK
Ga0184648_133154823300019249Groundwater SedimentMYIDHRNPRLRRGFAFVALAAVMGLALVGLTQCRLVNDTVTGVDLKSNTGLNARADCVQHCNEKY
Ga0180115_133993233300019257Groundwater SedimentMSLDHRTPRIRRGIGFIALASLLGVSALVLTQCRMVNDNVTGVDLKANATASAKSNCVRQCNEKRKACQKAEDARHKEAKKACLSDKACKKAEDAL
Ga0184644_105683423300019269Groundwater SedimentMNIDHRNPRVRRGFAFVALAAVLGLSAVGITQCRMVNDNVTGVDLRAGSGQLSARSSCVHRCNDDFKACLRAEE
Ga0184644_164062623300019269Groundwater SedimentMNIDHRNPRLRRGFAFVALAALLGLSVVSLSQCRMVNDTVTGVDIRANSGTSARSDCVRACNEARKSCMKSEDARHKAAQRACGSDHACKK
Ga0184642_132419123300019279Groundwater SedimentMNFDHRNPRLRRGFAFVALAAVLGLSAVGLTQCRLVDDTVTGVDLTSSNTFNPGNARSKCVHQCN
Ga0193727_109831713300019886SoilMHIDHRNPRVRRGFAFVALAAVLGLTAVGLTQCRMVNDNVTGVDLRAGNGQLSHRSSCVRHCNDLFKACIRAEEARYK
Ga0210356_12021923300021269EstuarineMNIDHRNPRLRRGFAFVALAAVLGLAAVGLTQCRNVSDSVTGVDLSNASGLHARNSCTRACHEQYKKCVRDEEKRYK
Ga0222624_113861223300021951Groundwater SedimentMNIDHRNPRVRRGFAFVALAAVLGLSAVGLTQCRMVNDNVTGVDLRAGNGQLSHRSSCSRACNDQFKSCIRAEEARFKAAK
Ga0222624_132577623300021951Groundwater SedimentMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLSSASGLSARSSCVRGCNDAFKSCLRAEQARHK
Ga0222624_158177513300021951Groundwater SedimentMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVDDTVTGVDLTANSGVNSRSDCVHRCNEQFKACQRAEEARHKSAQRACGHDKACKKAEERQ
Ga0213934_105461013300022156FreshwaterMNFDHRNPRLRRGFAFVALAAVLGLAAIGLTQCRMVNDSVTGVDLSANSGLSARSDCVHQCNEKYKACRRAEDARHKAAKRACP
Ga0222625_115836713300022195Groundwater SedimentMNIEHRNPRLRRGFAFVALAAVLGLSALGLTQCRMVDDTVTGVDVRSNDTFNGGHGRSHGRSRCVHRCNEGYKQCKRAEDSRYK
Ga0207644_1159361023300025931Switchgrass RhizosphereMNIDHRNPRLRRGFAFVALAAVLGLAAVGLTQCRMVNDNVTGVDLRSGNGQLSAKSACVKACNEQAKQCKKDEDARHKAAKQACASDNTC
Ga0207677_1093889623300026023Miscanthus RhizosphereMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHKQAQRDCG
Ga0207641_1252596313300026088Switchgrass RhizosphereMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHQCNDQYKACKRAEDARHKQA
Ga0207676_1053570923300026095Switchgrass RhizosphereMHFNHRTPRVRRGFTFVALAAVLGLAAVGLTQCRMVNDNVTGVDLRAGNGSLSGRSTCVHACNDQFKACIRAEEARFKAAKRACGSHNSACKKAEDRK
Ga0207675_10099930623300026118Switchgrass RhizosphereMNIDHRNPRVRRGFAFVALAAVLGLSAVGLTQCRMVNDNVTGVDLRAGNGQLSHRSSCSRACNDQFKSC
Ga0209803_122647113300026332SoilMNFDHRNPRLRRGFAFVALAAVLGLSAVGLSQCRLVDDSVTGVDLRSNSTAFSSARSKCVHQCNEKYKQCKKAEEALHKANKKACGSHDSACKKAE
Ga0209869_104740413300027187Groundwater SandMHIDHRNPRVRRGFAFVALAAVLGLSAVGLTQCRMVNDNVTGVDLRAGAGQLSARSSCVRRCNEAFKICVRNEEARFKIAKRACGGDYA
Ga0207428_1104852023300027907Populus RhizosphereMNIDHRNPRLRRGFAFVALAAVLGLSAVGLTQCRMVDNSVTGVDVRSNSGFHGSSSGRSKCVQQCNEAFKKCIKDEEARYKAAKKACKAIANSADRKACEKNEARIH
Ga0209583_1055467713300027910WatershedsMNIDHRNPRVRRGFAFVALAAVLGLSAVGLTQCRMVNDNVTGVDLRAGNGQLSARSSCARHCNDQFKACIRAEEARYKAQNKDAL
Ga0247646_123192913300030546SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLTSASGLGARSTCVRQCNAAFKDCQRAEAARHKSAKAACGSDN
Ga0247644_114700623300030576SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLTSASGLGARSTCVRQCNAAFKDCQRAEASRHKGAKAAC
Ga0247657_1027128913300030614SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLTSASGLGARSTCVRQCNAAFKDCQRA
Ga0247622_115992523300030682SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMTSDTVTGVDLTSASGLGARSTCVRQCNAAFKDCQRAEASRH
Ga0308152_11526923300030831SoilMNFDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLADDTVTGVDLTANSANARSDCVHRCNDQ
Ga0308183_113791813300030988SoilMNIDHRNPRLRRGFAFVALAALLGLSIVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHRCNDQFKACKRAEDARHKAAQRACGSDKACKK
Ga0308178_115624113300030990SoilMNIDHRNPRLRRGFAFVALAAVLGLSAVGLTQCRMTDDTVTGVDVRSNTSFSGGHGRSQCVHQCNEKYKA
Ga0308153_11384713300030994SoilMNIDHRNPRLRRGFAFVALAALLGLSIVGLSQCRMVDDTVTGVDLQANSGMNARSDCVHRCNDQFKACKRAEDARHKAAQRACGSDKACKKDEQRLHK
Ga0308185_103423423300031081SoilMNIDHRNPRLRRGFAFVALAALLGLSIVGLSQCRLVDETVTGVDIKASGLNGRSDCVHRCNDQYKKCIRAEESRHKNNKKHCHSDKQCGKGEERKHK
Ga0308197_1027149423300031093SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVNDNVTGVDLRSGNGQLSAKSACVKACNEQAKQCKKDEDARHKAAKQACMSDNACKKAEDQTH
Ga0308197_1029378713300031093SoilMNIDHRNPRLRRGFAFVALAAVLGLAAVGLTQCRMVDDTVTGVDVRSPGFNNARSDCVHQCNEKYKACKRAEDARYKAAVRACGNDVQCKKAD
Ga0308193_105476223300031096SoilMNIDHRNPRLRRGFAFVALAALLGLSVVSLSQCRMVNDTVTGVDIRANSGTSARSDCVRACNEARKSCMKSEDARHKAAQRACGSDHACKKAEQRQ
Ga0308187_1029662923300031114SoilMNIDHRNPRLRRGFAFVALAALLGLSVVSLSQCRMVNDTVTGVDIRANSGTSARSDCVRACNEARKSCMKSEDARHKAAQRACGGVQACKKAEQRLHQD
Ga0308187_1045410413300031114SoilMNIDHRNPRVRRGFAFVALAAVLGLTAVGLTQCRMLNDNVTGVDLRAGNGTLSHRSSCARHCNDQFK
Ga0308194_1025612523300031421SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLSQCRMVNDNVTGVDLRSGNGTLSARSACVKACNEQFKQCKRDEEVRHKAAKKACGSGSAGSACKK
Ga0308177_102395723300031423SoilMNFDHRNPRLRRGFAFVALAAVLGLSAVGLTQCRLVDDTVTGVDLTSSNTFNPGNARSKCVHQCNEKFKRCRKAEEATY
Ga0307473_1133442423300031820Hardwood Forest SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGITQCRMVNDNVTGVDLRAGAGSLSGRSSCVHRCNDSFKACLRAEESRYKAAK
Ga0315292_1076203713300032143SedimentMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVDDTVTGVDLQANSGTNARSDCVHQCNDQYKACKRAEYARHKAALRACGSGDDDNATNG
Ga0315295_1057813413300032156SedimentMNIDHRNPRLRRGFAFVALAAVLGLAAVGLSQCRMVDDTVTGVDVKSNTAFKSGRSACVHQCNLNYKNCIKTEEARHKAAIKACKALNPTS
Ga0315276_1128308323300032177SedimentMNIDHRNPRLRRGFAFVALAALLGLSVVGLSQCRLVDDTVTGVDLQANSGTNARSDCVHQCNDQYKACKR
Ga0307472_10148405513300032205Hardwood Forest SoilMNIDHRNPRLRRGFAFVALAAVLGLAAVGLTQCRAVNDTVTGVDLNSASGTSARSSCVHQCNSKFKDCLRSEFSRHKAASKACGSDNS
Ga0316628_10221873823300033513SoilMNIDHRNPRLRRGFAFVALAAVLGLAAVGLTQCRMVDDTVTGVDVRSNTGFSSGKSACVHQCNDKFKACIKAEEARHKAAKYNCRQLVDTPS
Ga0314789_030459_314_5233300034480SoilMHIDHRNPRVRRGFAFVALAAVLGLAAVGLTQCRMVNDNVTGVDLRSGNGQLSAKSACVKACNEQHKQCK
Ga0370545_115896_311_5953300034643SoilMNIDHRNPRLRRGFAFVALAALLGLSVVSLTQCRMVNDTVTGVDIRANSGTSARSDCVRACNEARKSCMKSEDARHKAAQRACGSDHACKKAEQR
Ga0370548_137088_318_5213300034644SoilMHIDHRNPRVRRGFAFVALAAVLGLTAVGLTQCRMVNDNVTGVDLRAGNGQLSARSSCVRHCNDLFKA
Ga0314782_060539_2_1693300034661SoilMSLDHRTPRIRRGIGFIALASLLGVSALVLTQCRMVNDNVTGVDLKANATASAKSN
Ga0314787_101458_323_5353300034665SoilMSLDHRTPRIRRGIAFIALASLLGVSALVLTQCRMVNDNVTGVDLKANTTASAKSNCTKQCNEKRKACQKA
Ga0314792_182028_323_5803300034667SoilMNIDHRNPRLRRGFAFVALAALLGLTVVGLSQCRMVDDTVTGVDLQANQGVNARSDCVHACNDAYKACKRAEDARHKQAQRDCGSD
Ga0314795_080480_324_6263300034670SoilMNTDHRNPRLRRGFAFVALAAVLGLAAFGLTQCRMVDDTVTGVDVRSNDSYNGWWHGRSHGRSRCVHQCDEKYKQCKRAEDARYKAAVKACGSNSTCKKNE
Ga0314799_020556_157_3873300034674SoilMNTDHRNPRLRRGFAFVALAAVLGLAAFGLTQCRMVDDTVTGVDVRSNDSYNGWWHGRSHGRSRCVHQCDEKYKQC


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.