NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085754

Metagenome / Metatranscriptome Family F085754

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085754
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 60 residues
Representative Sequence LFSGDGVAEFQKLGVQEISSIAGEAGEIFKRLAGLAVQRIAYQGMADGCQMDSDLMRAARI
Number of Associated Samples 100
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.14 %
% of genes near scaffold ends (potentially truncated) 56.76 %
% of genes from short scaffolds (< 2000 bps) 83.78 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.694 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(14.414 % of family members)
Environment Ontology (ENVO) Unclassified
(22.523 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.036 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 57.30%    β-sheet: 0.00%    Coil/Unstructured: 42.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF03449GreA_GreB_N 4.50
PF08327AHSA1 3.60
PF14279HNH_5 2.70
PF07228SpoIIE 1.80
PF00005ABC_tran 1.80
PF13517FG-GAP_3 0.90
PF02322Cyt_bd_oxida_II 0.90
PF00248Aldo_ket_red 0.90
PF01381HTH_3 0.90
PF01272GreA_GreB 0.90
PF04909Amidohydro_2 0.90
PF13560HTH_31 0.90
PF01872RibD_C 0.90
PF02075RuvC 0.90
PF12697Abhydrolase_6 0.90
PF13539Peptidase_M15_4 0.90
PF00171Aldedh 0.90
PF01047MarR 0.90
PF00216Bac_DNA_binding 0.90
PF06114Peptidase_M78 0.90
PF08031BBE 0.90
PF01850PIN 0.90
PF01566Nramp 0.90
PF01909NTP_transf_2 0.90
PF00392GntR 0.90
PF00561Abhydrolase_1 0.90
PF08818DUF1801 0.90
PF00588SpoU_methylase 0.90
PF01095Pectinesterase 0.90
PF13570PQQ_3 0.90
PF00375SDF 0.90
PF13610DDE_Tnp_IS240 0.90
PF01661Macro 0.90
PF12158DUF3592 0.90
PF12802MarR_2 0.90
PF00719Pyrophosphatase 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 5.41
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.90
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.90
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.90
COG4677Pectin methylesterase and related acyl-CoA thioesterasesCarbohydrate transport and metabolism [G] 0.90
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.90
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.90
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.90
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.90
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.90
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.90
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.90
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 0.90
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.90
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.90
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.90
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.90
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.90
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.90
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.69 %
UnclassifiedrootN/A6.31 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003432|JGI20214J51088_10521482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium762Open in IMG/M
3300005187|Ga0066675_11294765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium538Open in IMG/M
3300005216|Ga0068994_10138347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium655Open in IMG/M
3300005331|Ga0070670_101444981All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300005332|Ga0066388_108699277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium504Open in IMG/M
3300005364|Ga0070673_101446130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium647Open in IMG/M
3300005548|Ga0070665_101993764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium586Open in IMG/M
3300005548|Ga0070665_102264802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium547Open in IMG/M
3300005564|Ga0070664_101200215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium716Open in IMG/M
3300005577|Ga0068857_101435612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium672Open in IMG/M
3300005587|Ga0066654_10815142All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium531Open in IMG/M
3300005616|Ga0068852_102761325All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium510Open in IMG/M
3300005712|Ga0070764_10892172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium557Open in IMG/M
3300005950|Ga0066787_10083222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium661Open in IMG/M
3300006358|Ga0068871_102217461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium523Open in IMG/M
3300009029|Ga0066793_10369039All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.826Open in IMG/M
3300009032|Ga0105048_10861975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium801Open in IMG/M
3300009084|Ga0105046_10832334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium789Open in IMG/M
3300009181|Ga0114969_10482998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium696Open in IMG/M
3300009500|Ga0116229_10189078All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300009551|Ga0105238_11042856All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300009623|Ga0116133_1023848All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1512Open in IMG/M
3300009638|Ga0116113_1209105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium507Open in IMG/M
3300009665|Ga0116135_1012682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2973Open in IMG/M
3300009697|Ga0116231_10745877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium533Open in IMG/M
3300010366|Ga0126379_11799746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium716Open in IMG/M
3300010397|Ga0134124_12480096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium560Open in IMG/M
3300012925|Ga0137419_10526761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium941Open in IMG/M
3300013100|Ga0157373_11110774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium593Open in IMG/M
3300013308|Ga0157375_11378803All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium830Open in IMG/M
3300014168|Ga0181534_10471627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium706Open in IMG/M
3300014325|Ga0163163_11973164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium643Open in IMG/M
3300014326|Ga0157380_11937194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium650Open in IMG/M
3300014495|Ga0182015_10469308All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium806Open in IMG/M
3300014657|Ga0181522_10673509All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium630Open in IMG/M
3300014838|Ga0182030_10097253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4098Open in IMG/M
3300014838|Ga0182030_10978445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium747Open in IMG/M
3300014969|Ga0157376_12178156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium593Open in IMG/M
3300015052|Ga0137411_1278440All Organisms → cellular organisms → Bacteria3731Open in IMG/M
3300016445|Ga0182038_11427020Not Available620Open in IMG/M
3300017659|Ga0134083_10446205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium571Open in IMG/M
3300017988|Ga0181520_10053075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3832Open in IMG/M
3300017988|Ga0181520_10498191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium863Open in IMG/M
3300017988|Ga0181520_10781545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium645Open in IMG/M
3300018009|Ga0187884_10376183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium572Open in IMG/M
3300018022|Ga0187864_10309613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium702Open in IMG/M
3300018023|Ga0187889_10410015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium585Open in IMG/M
3300018042|Ga0187871_10430088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_46_13729Open in IMG/M
3300018043|Ga0187887_10858006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium537Open in IMG/M
3300020147|Ga0196976_1081541All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300020583|Ga0210401_10355143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1327Open in IMG/M
3300021401|Ga0210393_10262140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1402Open in IMG/M
3300021403|Ga0210397_11502283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium523Open in IMG/M
3300021405|Ga0210387_10854626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium802Open in IMG/M
3300025140|Ga0209724_1200946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium639Open in IMG/M
3300025412|Ga0208194_1051375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300025924|Ga0207694_11206996All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300025927|Ga0207687_10020617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4375Open in IMG/M
3300025941|Ga0207711_10439334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1214Open in IMG/M
3300026116|Ga0207674_11159599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium742Open in IMG/M
3300026308|Ga0209265_1220739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium518Open in IMG/M
3300026456|Ga0255351_1020165All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300026557|Ga0179587_10462973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium830Open in IMG/M
3300027698|Ga0209446_1068785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium901Open in IMG/M
3300027767|Ga0209655_10301162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium517Open in IMG/M
3300027889|Ga0209380_10154414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1342Open in IMG/M
3300027894|Ga0209068_10781804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium562Open in IMG/M
3300027895|Ga0209624_10685864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium677Open in IMG/M
3300027911|Ga0209698_11239873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium548Open in IMG/M
3300028082|Ga0255352_1018247All Organisms → cellular organisms → Bacteria1316Open in IMG/M
3300028381|Ga0268264_11392705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium712Open in IMG/M
3300028748|Ga0302156_10016717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4445Open in IMG/M
3300028762|Ga0302202_10038592All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3263Open in IMG/M
3300028868|Ga0302163_10201659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium551Open in IMG/M
3300028909|Ga0302200_10012573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5838Open in IMG/M
3300029914|Ga0311359_10825651All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300029914|Ga0311359_10827338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium645Open in IMG/M
3300029917|Ga0311326_10239418All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300029945|Ga0311330_11156735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium562Open in IMG/M
3300029955|Ga0311342_10497742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1021Open in IMG/M
3300029982|Ga0302277_1244419All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium679Open in IMG/M
3300029997|Ga0302302_1216148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium717Open in IMG/M
3300030049|Ga0302191_10169001All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300030053|Ga0302177_10335940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium800Open in IMG/M
3300030054|Ga0302182_10362904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium608Open in IMG/M
3300030114|Ga0311333_11384649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4604Open in IMG/M
3300030399|Ga0311353_11262038All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300030518|Ga0302275_10124475All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300030520|Ga0311372_11891339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium706Open in IMG/M
3300031003|Ga0074003_13178601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium536Open in IMG/M
3300031003|Ga0074003_13841643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium634Open in IMG/M
3300031231|Ga0170824_100909737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium536Open in IMG/M
3300031236|Ga0302324_102471374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium635Open in IMG/M
3300031524|Ga0302320_10094354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4860Open in IMG/M
3300031524|Ga0302320_10618218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1260Open in IMG/M
3300031524|Ga0302320_11781185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium588Open in IMG/M
3300031672|Ga0307373_10370455All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium853Open in IMG/M
3300031708|Ga0310686_111956910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium624Open in IMG/M
3300031708|Ga0310686_112098277All Organisms → cellular organisms → Bacteria3025Open in IMG/M
3300031748|Ga0318492_10507206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium640Open in IMG/M
3300031788|Ga0302319_10465102All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300031813|Ga0316217_10338180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium574Open in IMG/M
3300032420|Ga0335397_10210776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1829Open in IMG/M
3300032675|Ga0316225_1011993All Organisms → cellular organisms → Bacteria4565Open in IMG/M
3300034130|Ga0370494_013674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2113Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog14.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.31%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.50%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.50%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.60%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.60%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.70%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.80%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.80%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.80%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.80%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.80%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.80%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.90%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.90%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.90%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.90%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005216Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009084Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly)EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009697Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020147Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13CEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300025140Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028082Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031003Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300034130Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20214J51088_1052148213300003432WetlandMDFFSGDGVLEFQKLGMQTISSIAGESGVIFERLAVSSIQRIANQGMADGCQMDSDLMRAARI*
Ga0066675_1129476513300005187SoilVLEFQKLSVQEISSVAREAGKIFKRLAGEAVQTIAYQGMADGCQMDSDLMRAAR
Ga0068994_1013834713300005216Natural And Restored WetlandsMDLYAGDGVVEFQELGVQEISSIAGEAGIRFKRLAGEAVQRIADQGMSDGCQMDSDLMRAARIQAYLKCRRVRAA*
Ga0070670_10144498133300005331Switchgrass RhizosphereVGVQEISSVARQAGEILKGLAGEAVQRIAHQRMADGCQMDSDLMRT
Ga0066388_10869927713300005332Tropical Forest SoilVEFQKLGVQEISSIAGEAGEIFKRLAGCAVQRIAYQGMADGCQMDSDLMRAARTQAYLK
Ga0070673_10144613013300005364Switchgrass RhizosphereVVEFQILGVQEISSIAREAGEIFKRLAGYAVQRIAYQGMADGCQMDSDLMRAAGIQAYLKCCGVGGA*
Ga0070665_10199376413300005548Switchgrass RhizosphereLQILGVQEISPIAGEAGEIFKRLAGHAVQGITYQGMADGCQMDSDLMRAAR
Ga0070665_10226480213300005548Switchgrass RhizosphereMVEFQELGVQEISSIAGEAGEIFKRLAGQAVQRIAYQGMADGCQMDSDLMRAAR
Ga0070664_10120021523300005564Corn RhizosphereMDLFPGDGMVEFQVLSMQQISSIAGEAGEIFKRPAGEAVQGIANQRMADRRQMDSDLMRPARVQTDLKCCSAVLA*
Ga0068857_10143561223300005577Corn RhizosphereMDLLSGDGMVEFQKLGVQEISSIAGKAGEIFKRLAGQAVQRIAYQGMADGCQMDSDLMRAARI
Ga0066654_1081514213300005587SoilVLEFQKLSVQEISSVAREAGKIFKRLAGEAVQRIAYQGMADGCQMDSDLMRA
Ga0068852_10276132523300005616Corn RhizosphereLGVQEIASITGEAGEIFERLAVQAIQRIAQQGMADGGQMDSDLMRAAR
Ga0070764_1089217213300005712SoilMDLFSGDGVVEFQKLGVQEISSIAGETGVIFKRLARYAVQGVANQGMSDRCQMDSDLMRAARIQAYLKCCGACGA*
Ga0066787_1008322213300005950SoilVVEIQKLGVQEISAIAGEAGEIFKRLAGEAVQRIADQGMSDGCQMDSDLMRASRI
Ga0068871_10221746123300006358Miscanthus RhizosphereMDLFSGDGVVELQIVSVQEISSIAGEAGEIFKRLAGEAVQRIAYQGMADGCQMDSDLMRAARIQA
Ga0066793_1036903913300009029Prmafrost SoilLFSGDGVAEFQKLGVQEISSIAGEAGEIFKRLAGLAVQRIAYQGMADGCQMDSDLMRAARI*
Ga0105048_1086197523300009032FreshwaterMDWFSGDGVAEFQILGVQGKSSVAGEAGEIFKRLAGWAVERIACQGMADRCQMDSDLMGAARI*
Ga0105046_1083233413300009084FreshwaterLFSGDGVVEFQVLGVQEISSITGEAGEIFKRLAGYAVQRIADQGMADGCQMDSDLMRATRT*
Ga0114969_1048299813300009181Freshwater LakeLFSGDGVVEFQIVGVEEIASVAGEAGEIFERLAGGAVQRIACEGMAEGGQVDSDLMGSARVQAYLKGCCC
Ga0116229_1018907833300009500Host-AssociatedMDWFSGEGVGEFQELGVQEIASIAGEAGEIFKRLAGEAVQRVTYQGMADGCQVDADLMRTARMQAYLERCGAC
Ga0105238_1104285623300009551Corn RhizosphereMDLFSCDGVVESQKLGVQKVSSIAGQAGVILKWLAGCAVQGIANQGM
Ga0105238_1127962623300009551Corn RhizosphereMHWESRRQSCLKIDSLSGDGVLKVEISRVQEVSSIAGQAGETFERLTGEAVKRIADQRMPDGCQM
Ga0116133_102384813300009623PeatlandLFSCDGVVEFQKLGVQEISSIAREAGEIFERLAGEAVQRIAYQGMADGCQMDSDLMRAARI*
Ga0116113_120910513300009638PeatlandLFSADRVVEFQTLGVQEISSTAGEAGEIFKRLAGEAVQRIAYQGMADGCQMDSDLMRAARMESY
Ga0116135_101268223300009665PeatlandLFSCDGVVEFQKLGVQEISSIAREAGEIFERLAGEAVQRIAYQGMADGCQMDSDLMRAART*
Ga0116231_1074587723300009697Host-AssociatedMDLFTRDGVVEFQILGVQEISSIAGEAGQIFKRLAGEAVERIAYQGMADGCQMD
Ga0126379_1179974613300010366Tropical Forest SoilMDLLSVDGVVEFQKLGVQQISSIAGEAGEIFKRLAGGTIQRIAHQGMADGRQMDSDLMRAARMETYLKRRRA
Ga0134124_1248009613300010397Terrestrial SoilVVEFKILGVQEVSSIAGEAREVFKRLAGYSVQRIAYQRMADGCQMDSDLMRAARI*
Ga0137388_1107843723300012189Vadose Zone SoilMQWESRRQSCLKIDLFSGDGVVEFQILGVQEISSIAGEAGEILKRLAGEAVQRIAYQGMADGCQM
Ga0137419_1052676113300012925Vadose Zone SoilMQEISSIAGEAGKIFKRLAGYAVQRIAYQGMADGCQMDSDLMRAARI*
Ga0157373_1111077423300013100Corn RhizosphereMDLFSGNGVVKFQKLGVQEISSIAREAGALVKRLAGYAVQRIAHQGVSDKCQMDSDLMRAAR
Ga0157375_1137880313300013308Miscanthus RhizosphereLFSGDGVVEFQILGVQEISSIAREAGEIFKRLAGYAVQRIAYQGMAYGCEVDSDLMRPARTKAHLKCCVAGDA*
Ga0181534_1047162713300014168BogMDGFTGDGVGELEKLRVQEVASVAGEAGEIFKRLAGWAVEGIADQGMADGCEMDSDLMRAARAEAYFKCCGAGGA
Ga0163163_1197316413300014325Switchgrass RhizosphereLFSSDGVVKFQVLGVEEISSIARKAGEIFKRLAGYAVQRIAYQGMADGCQMDPDLMRAARIQAYLKCCSA
Ga0157380_1193719413300014326Switchgrass RhizosphereMGWLEFQKLGVQEISSIAREAGEVFKRLAGQAVQRIAHQGMADGCQVDSDLMRAARI*
Ga0182015_1046930823300014495PalsaLFSGEGVVEFQKLGVQEISSIAGEAGKVFKRLAGQAVQRIAYQGMADGCQMDSDLMGAARIQAYL
Ga0181522_1067350923300014657BogLFSGDRVVEFQELGVQEIASIAGEAGEIFKRLAGYAVQRIAYQGMADGCQVDSDLMRAARI*
Ga0182030_1009725313300014838BogMDLFSCDGVLEFQKLGVQEISSIAREAGEIIKRLAGRAVQRIANQGMADGCQMDSDLMRAARIQA
Ga0182030_1097844513300014838BogLFSGDGVVDFQILGVQEISSIAGEAGEIFKRLAGWAVQRIAYQGMADGCQMDSDLMRAARIQ
Ga0157376_1217815613300014969Miscanthus RhizosphereMQQEPGRQSCLKIDLFSGDGVVEFQIVGVQEISSIAGKAGEIFKRLAGEAVQWIAYQGMADGCQMDSD
Ga0137411_127844033300015052Vadose Zone SoilMDLFFGDGVVEIQILGVQEISSIAGEAGEVFKRLAGKAVQRIAYQGMADGCQMDSDLMRAARI*
Ga0182038_1142702023300016445SoilLGVQEISSIARDPGEIFKRLAMTTVQRIADQPMADGGQMDSDL
Ga0134083_1044620513300017659Grasslands SoilVVEFQKLSVQEMSSIAREARDIFKRLAGEAVQRIAYQRMADGCQMDPDLMRAARLQAYLKCCG
Ga0181520_1005307513300017988BogVVEFQKLGVQKISSIAGEAGKIFKWLAVYSVQTIANQGMADGGQMNSDLMRAARMQAY
Ga0181520_1049819113300017988BogMDLFSADGVVEFQKLGVQEISSVAGEAGKIFKRQAGRAVQRIPYQGMADGGQMDSDLMRAARMQAYLKCCGAWVA
Ga0181520_1078154523300017988BogMQGESGRQSCFKIDLLAGDGVVEFQKLGMQEITSIAGEAGEILKRLAGQAVERVAHQGMADGCQMDSDLMRAARM
Ga0187884_1037618323300018009PeatlandSSIAREAGEILKRLAGKAVQRIAYQRMSDGCQMDSDLMRASRI
Ga0187864_1030961323300018022PeatlandLFSGDGVLEIQKLGVQEISSIAREAGEILKRLAGKAVQRIAYQRMSDGCQMDSDLMRASR
Ga0187889_1041001513300018023PeatlandVVEFQKLGVQQISSIAGEAGEIFKRLAVYAVQRIAKQGMADGGQMDSDLMRAA
Ga0187871_1043008813300018042PeatlandMKQAESGGQRCLKMDLLSGDGVLEVQKLGVKQISSVAGKAGELCKRLAVCAVKRIADQWMTDGGQMDSD
Ga0187887_1085800613300018043PeatlandVVEFQKLRVQEISSIAGEAGKVFKRLAGQAVQRIAYQGMADGCQMDSDLM
Ga0066662_1267271613300018468Grasslands SoilVNLRIQRESGRPRCLKIDLFSGDGVAKSQMLGVQEIARIAREAGEIFKRLAGCAVQRIAY
Ga0196976_108154113300020147SoilLGVQEISSVAGEAREISKRLTVKAVQRIAYQGMADGCQMDSDL
Ga0210401_1035514323300020583SoilMDLFSGEGVLEIQELGVQEISSIAGEAGVMFKRLAGYAVQRIANQRVADGCQMDSDLMRAARI
Ga0210393_1026214023300021401SoilVQEISSVAGEAGEIFKRLAGYTVQRIAYEGMADGCQMDSDLMRASGIQGY
Ga0210397_1150228313300021403SoilVVEFEKLGVQEISSVAGETGKIFKRLAGYAVQGIANQGMADGCQMDSDLMRAART
Ga0210387_1085462613300021405SoilMQWESGRQSCLKIDLFSGDRVLEFQKLGVQKISSIAGQAGKIFKRLAAYAVQRIAYQGMADGCQMDSDLMRPA
Ga0209724_120094623300025140Glacier ValleyVDLFAGDGVVELQGSGVEEVASVAGEAGEVFEGMAGGAVEGIAYERMTDGGEMNSDLMGAARVQA
Ga0208194_105137523300025412PeatlandLGVQEISSIAREAGEIFERLAGEAVQRIAYQGMADGCQMDSDLMR
Ga0207694_1120699623300025924Corn RhizosphereMDLFSCDGVVESQKLGVQKVSSIAGQAGVILKWLAGCAVQGIANQGMADRRQMDSDLM
Ga0207687_1002061753300025927Miscanthus RhizosphereVDEFYILRVQEISSIAGKTGAIFKRQAGRTIKRIADQGMADGCQMD
Ga0207711_1043933413300025941Switchgrass RhizosphereVDEFYILRVQEISSIAGKTGAIFKRQAGRTIKRIADQGMADGCQMDSDL
Ga0207674_1115959923300026116Corn RhizosphereMDLLSGDGMVEFQKLGVQEISSIAGKAGEIFKRLAGQAVQRIAYQGMADGCQMDSDLMRAARIEAYLKCCGAGGA
Ga0209265_122073913300026308SoilVLEFQKLSVQEISSVAREAGKIFKRLAGEAVQTIAYQGMADGCQMDSD
Ga0255351_102016513300026456SoilMDLFSGDGVLEFQELGVQEISSIAGEAGEIFNRLAAQSVQRIAHQGMADGCQMDSDLMRAARMQAYLKCCGA
Ga0179587_1046297313300026557Vadose Zone SoilMQEISSIAREAGEIFKRLAGQAVQRIAYQRMADGCQMDSDLM
Ga0209446_106878523300027698Bog Forest SoilLFSGDGVLEIQKLGVQEISSIAREAGEIFKRLAGEAVQRIAYQGMADGCQMDSDLMRAAG
Ga0209655_1030116213300027767Bog Forest SoilMDLFSGEGVLEIQELGVQEISSIAGEAGVMFKRLAGYAVQRIANQRVADGCQMDSDLMRPARI
Ga0209380_1015441433300027889SoilLGVQEISSIAREAREIFERLAGEAVQRIAYQGMADGCQMDSDLMRAA
Ga0209068_1078180413300027894WatershedsLGVQEISSIAREAGEIFKRLAGYAVQRITYQGMADGCQMDSDLM
Ga0209624_1032948723300027895Forest SoilMQWESRRQSCLKIDLFSGDGVVKFQEEGVQEISSIAREAGEIFKRLAREAVQRIAHQGMADGCQMDS
Ga0209624_1068586423300027895Forest SoilVQEISSIAGEAGEIFKRLAGYTVQRIANQRMADGCQMDSDLMRAAGIQ
Ga0209698_1123987323300027911WatershedsVVKFQKLGVQKITSIARKAGEIFKRQAGRAVQRIAHQGMADGCKMDSDLMGAAGIEAYSKYC
Ga0255352_101824733300028082SoilLFSGDGVVEFQKLRVQQISSIAGEAGEIFKRLAGYPVQRIAYQGMADGCQMDSDLMRAAG
Ga0268264_1139270513300028381Switchgrass RhizosphereLKLQKLSVQEISSIAREAGKVFKRLTGEAVQRIAYQGVADGCQMDPDLVRAARIKSYLKCCC
Ga0302156_1001671773300028748BogVVEFQELGVQEISSIAGEAGEIFKRLAACAVQRIANQGMADRCQMDSDLMRAP
Ga0302202_1003859273300028762BogMLEFQKLGVQEISSIAGEAGEIFKRLAACAVERIADQGMADGCQMDSDLMRAARMQAYLKCCGA
Ga0302163_1020165933300028868FenMQWKFWRQSCLKVDLFSGDGVLELQKLGVQEISSVAGKAGEIFERLAGQAVQRIAYQGMADEC
Ga0302200_1001257393300028909BogVVEFQELGVQEISSIAGEAGEIFKRLAACAVQRIAYQRMADGCQMDSDLMRAARI
Ga0311368_1096931113300029882PalsaMGQESRRQSCLKLDRFSGDGVVKLQKLGMQQISSITREAGQSCKRLAGWAIQWIAHQGMPDGR
Ga0311359_1082565123300029914BogMDLFSSDRVLEFQILGVQEISSIAGEAWEIFKRLAGEAVQRIAHQGMADGCQMDSDL
Ga0311359_1082733813300029914BogLGVQEISSVAGEAGEILKRLAGWTVEWIAYQGMADGCEMDSDLMRAAGMQGYFECRGASCGVRPFCG
Ga0311326_1023941823300029917BogMQEISSIAGKAGKIFKRLAGEAVERIAYQGMADGCQMDSDLMR
Ga0311330_1115673513300029945BogLGVEEIASIAGEAGEIFKRLAAGAVQRVAYQGMADGCQMDPDLMRAARMQAYFK
Ga0311342_1049774223300029955BogVQKISSIAGEAGEIFKRLAGEAVQGVAYKGMADGCQMDS
Ga0302277_124441913300029982BogMQWEAGRQSRLKIDLFSGDGVVEFQILGVQEIASIAGEAGEIFKRLACEAVERIAYQGMADGCQ
Ga0302302_121614823300029997PalsaVQEISSIAGEAGEIFKRLAAHAVQRIAYQGMADGCQMDSDLMRTARMQAYLECCGAC
Ga0302191_1016900113300030049BogMDLFSGDGVLEFQELGVQEISSVAGEAGEIFKRLAAQSVQRIADQGMADGCQM
Ga0302177_1033594023300030053PalsaMELFSGDGVGEFQELGVQEIASVAGEAGEIFERLAGWAVQRIAYEGMADGGEVDSDLVRAAGVQAYLKCCGAG
Ga0302182_1036290423300030054PalsaVQEISSIAGEAGEIFKRLAAHAVQRIAYQGMADGCQMDSDLMRTARMQAYLECCGACA
Ga0311333_1138464913300030114FenIAGEAGKVFKRLAGQAVQRIAYQGMADGCQMYSDLMRAARI
Ga0311353_1126203823300030399PalsaMELFSGDGVGEFQELGVQEIASVAGEAGEIFERLAGWAVQRIAYEGMADGGEVDSDLVRAAGVQ
Ga0302194_1039472613300030506BogLLDNIRFLLMQRESPRQSCLKIDLFSSDGVLEFQKLGVQEISSIAGEAGEIFKRLAGYTVQRI
Ga0302275_1012447543300030518BogMLEFQKLGVQEISSIAGEAGEIFKRLAACAVERIADQGMADGCQMDSDLMRAARREAYLKGCGARVCCGACAA
Ga0311372_1189133913300030520PalsaMDGLAGDGVVEFQELGVQEIASVAGESGEIFEGLAGGAVEGIAYEGMADGCQMDSDLMRAAGVEAYLKCCGGCRACDDLC
Ga0074003_1317860113300031003SoilVVEFKELGVQEISSIAREARKVLKRLAGEAVQRIAYKRMADGGQMDPDLVRAPGMEADLKGCGACGS
Ga0074003_1384164313300031003SoilVDEFQILGVEEIASITWEAGEIFQRLAGGAVQRIAYQRMADGCQMDPDLVRAARREAYLERRGACGA
Ga0170824_10090973713300031231Forest SoilMVKSKELGVQQIASVAWQAGEIFKRLAGCAVQRIAYQGMADGCQMDSDLMRAARI
Ga0302324_10247137413300031236PalsaLGVEEIASIAGEAGEIFKRLAAGAVQRVAYQGMADGCQMDPDLMRAARMQAYFKCSVACA
Ga0302320_1009435413300031524BogLFSGDRVLKFQRLGVQKISSIAGEAGEIFKRLAGEAVQGVAYKGMADGCQMDSDLMRAAR
Ga0302320_1061821813300031524BogLGVEEIASIAGEAGEIFKRLAAGAVQRVAYQGMADGCQMDPDLMRA
Ga0302320_1178118513300031524BogVVEFQKLGVQEISSIAGEAGEIVKRLAGYPVQRIANQGMADGCQMDSDLMRAARI
Ga0307373_1037045523300031672SoilMDLFSGDGVVENQKLCVQEISAIAREAGETFKRQAGWGVQRIAYQGVTDGCQMDPDLMRTARM
Ga0310686_11195691013300031708SoilVVEFQKLGVQEISSIAGEAGKVFKRLAGQAVQRIAYQGMADGCEMDSDLMRAARI
Ga0310686_11209827733300031708SoilMQKISSTAGKAGEIFKRLAGKAVQRIAYQGMADGCQMDSDLMRAAGIYAYLKCCCAGGA
Ga0318492_1050720613300031748SoilMDLLSGNGVVEFQKLGVQEISSIAGEAGEIFERLAGYAVQRIAYQGMADGCEMDSDLMRAARMQSHLKCCRAGAA
Ga0302319_1046510233300031788BogMDLFSSDRVLEFQILGVQEISSIAGEAWEIFKRLAGEAVQRIAHQGMADGCQMDSDLMRAARTQADLKCRGA
Ga0316217_1033818013300031813FreshwaterVKEFQKLGVQEISSIAGEAGEVFKRLAARAVQRIANQGMADGCQMDPDLMRAARI
Ga0335397_1021077613300032420FreshwaterCLKMDWFSGDGVAEFQILGVQGKSSVAGEAGNIFKRLAGWAVERIACQGMADRCQMDSDLMGAARI
Ga0316225_101199373300032675FreshwaterMQLESRRQSRLKIDLFSGDGMVEFQKLGVQKISSIAGETREIFKRLAGYPVQRIAYQGMADGCQMDSDLMRAART
Ga0370494_013674_1_2163300034130Untreated Peat SoilMQSETGRQSRLKMDLFSGDGVLEFQELGVQEISSIAGEAGEIFNRLAAQSVQRIAHQGMADGCQMDSDLVRA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.