Basic Information | |
---|---|
Family ID | F085257 |
Family Type | Metagenome |
Number of Sequences | 111 |
Average Sequence Length | 44 residues |
Representative Sequence | VGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 90.09 % |
% of genes from short scaffolds (< 2000 bps) | 97.30 % |
Associated GOLD sequencing projects | 63 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (98.198 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (90.090 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.892 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (90.991 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF14223 | Retrotran_gag_2 | 0.90 |
PF12146 | Hydrolase_4 | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 98.20 % |
All Organisms | root | All Organisms | 1.80 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 90.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.90% |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013754 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep2 | Environmental | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068869_1016321581 | 3300005334 | Miscanthus Rhizosphere | LLFACFGRVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNL* |
Ga0068867_1019790952 | 3300005459 | Miscanthus Rhizosphere | LLAGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVF |
Ga0068866_112939672 | 3300005718 | Miscanthus Rhizosphere | INHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0068865_1020755331 | 3300006881 | Miscanthus Rhizosphere | VINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0157374_116764242 | 3300013296 | Miscanthus Rhizosphere | SPKGGDCKENGPLANLLWILVFDEQHNQIGLMNL* |
Ga0157374_120806992 | 3300013296 | Miscanthus Rhizosphere | RVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0120183_10127892 | 3300013754 | Terrestrial | LFACFGRVVIKHQKGGDCKENGPRPILVWILVFDDQQDQIGLMCLQVFVL* |
Ga0182122_10224991 | 3300015267 | Miscanthus Phyllosphere | RVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNL* |
Ga0182122_10462532 | 3300015267 | Miscanthus Phyllosphere | MYELGRVVINHQKGEDCKENGPLAHLVWILVFDDQQDQIRLMYL* |
Ga0182154_10398921 | 3300015268 | Miscanthus Phyllosphere | LLFACFGHVGINHQKEGDYKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182113_10702331 | 3300015269 | Miscanthus Phyllosphere | HQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182113_10752771 | 3300015269 | Miscanthus Phyllosphere | VFKIPHFLLFACFGRVVINHQKGGDFKENGPLAHLVWIFVFDDQYNQIGLMNLRVFVL* |
Ga0182113_10919811 | 3300015269 | Miscanthus Phyllosphere | KGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182172_10209942 | 3300015275 | Miscanthus Phyllosphere | LFACFGRVVINHQKGGDCKENGPLAHLLWILVVDDQHNQIGLMNLQVIVL* |
Ga0182170_10417841 | 3300015276 | Miscanthus Phyllosphere | LLSAPCKENGPQDHLLWILVFDDQHNQIGLMNLQVIIL* |
Ga0182170_10665051 | 3300015276 | Miscanthus Phyllosphere | TSKFLLFACFGRVGINHQKGGDCKENGPLAHLLWILVFDVQHNQIGLMNLQVFVL* |
Ga0182128_10566101 | 3300015277 | Miscanthus Phyllosphere | GDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182174_10070751 | 3300015279 | Miscanthus Phyllosphere | NHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVIVL* |
Ga0182174_10401481 | 3300015279 | Miscanthus Phyllosphere | VINHQKRGDCKENGPLAHLVWILVFDDQHNQVGLMCLQVYVL* |
Ga0182160_10176052 | 3300015281 | Miscanthus Phyllosphere | SKFLLFACFGRVGINHQKGGDCKENGPLAHLLWISVFDDQHNQIGLMNLQVFVL* |
Ga0182160_10276101 | 3300015281 | Miscanthus Phyllosphere | TSKFLLFAYFGRVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNL* |
Ga0182156_10187771 | 3300015283 | Miscanthus Phyllosphere | QKWGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVIIL* |
Ga0182156_10190651 | 3300015283 | Miscanthus Phyllosphere | FACFGRVVINHQKGRDCKENRPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182186_10633161 | 3300015285 | Miscanthus Phyllosphere | LLFACFGRVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVF |
Ga0182186_10660481 | 3300015285 | Miscanthus Phyllosphere | LLFACFGRVVINHQKGADCEENGPEAHLLWILVFDDQHNQIGQINLQVIVL* |
Ga0182176_10185481 | 3300015286 | Miscanthus Phyllosphere | HGACKENGPYAYLLWILVFDDQHNQIGLMNLQVIVL* |
Ga0182176_10428621 | 3300015286 | Miscanthus Phyllosphere | TIFPLWNCKENGPLAHLLWILVFDEQHNQIGLMNLQVFVL* |
Ga0182176_10428811 | 3300015286 | Miscanthus Phyllosphere | FLLFTCFGRVGINHQKGGDCKENGPLAHLLWILVFDVQHNQIGLMNLQVFVL* |
Ga0182176_10746682 | 3300015286 | Miscanthus Phyllosphere | INHQKGEDCKENGPLAHLLWILVFDDQHNQIELMNLQVFVL* |
Ga0182176_10832192 | 3300015286 | Miscanthus Phyllosphere | GINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182171_10325142 | 3300015287 | Miscanthus Phyllosphere | LNFTFLLFACFGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182171_10719671 | 3300015287 | Miscanthus Phyllosphere | INHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMTLQVFIL* |
Ga0182173_10736691 | 3300015288 | Miscanthus Phyllosphere | GRDCKKNGPQAQLLWILVFDDQHNQIGLMDLQVIVL* |
Ga0182138_10862371 | 3300015289 | Miscanthus Phyllosphere | FACFGRVVIKHQKGGDCKENGPFANLVWILVFDDQHDQVGLMNLQVFVL* |
Ga0182125_10244611 | 3300015291 | Miscanthus Phyllosphere | LETPVEGCKENGPLAHLLWILVFDDQHNQIGLMNLQVIV |
Ga0182125_10475571 | 3300015291 | Miscanthus Phyllosphere | VVINHQKGGDCKENGPLAHLLWILVFDDQHNHIRLINLQVIVL* |
Ga0182125_10835741 | 3300015291 | Miscanthus Phyllosphere | HCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182141_10470341 | 3300015292 | Miscanthus Phyllosphere | RVVINHQKWGDCKKNGLYAHLLWILVFDDQHNQIGLMNLQVIVL* |
Ga0182175_10488622 | 3300015295 | Miscanthus Phyllosphere | QKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182106_10581281 | 3300015298 | Miscanthus Phyllosphere | GRVVINHQKGGDCKENGPEAHLLWILVFDDQHNQIGLMNLQVIVL* |
Ga0182107_10203961 | 3300015299 | Miscanthus Phyllosphere | GDCKENGPLAHLLWILVFDDQHNQIGLINLQVIVL* |
Ga0182107_10569011 | 3300015299 | Miscanthus Phyllosphere | KGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182108_10817371 | 3300015300 | Miscanthus Phyllosphere | GGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182143_10534781 | 3300015302 | Miscanthus Phyllosphere | HYCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL* |
Ga0182143_10705371 | 3300015302 | Miscanthus Phyllosphere | IVPWCKENGSLVHLFWILVFDDQHNQIGLMNLKVFVL* |
Ga0182123_10112571 | 3300015303 | Miscanthus Phyllosphere | LLFACFGHVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQV |
Ga0182123_10301642 | 3300015303 | Miscanthus Phyllosphere | FGRVVIDHQKRGDYKENRPYAHLLWILVFDDQHNQIGLMNWQVIVLLFSRVQDMT* |
Ga0182123_10805941 | 3300015303 | Miscanthus Phyllosphere | QKGGDCKENGPLAHLLWILVFDDQHNQIGLMNFLVIVL* |
Ga0182112_10424772 | 3300015304 | Miscanthus Phyllosphere | GRVVINHQKGGDYKENGPLAHLLWILVFDDQHDQIGLMNLQVIVL* |
Ga0182158_10538462 | 3300015305 | Miscanthus Phyllosphere | LLFACFGHVVINHQKEGDCKENGPYTHSLWILVFDDQHNLIGLMNLQVIVL* |
Ga0182158_10999581 | 3300015305 | Miscanthus Phyllosphere | FGHTIINHQKGEDCKENRPLAYLLRILVFDDQQNQIGLMCL* |
Ga0182144_10629321 | 3300015307 | Miscanthus Phyllosphere | LLFACFGHVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVF |
Ga0182142_11131952 | 3300015308 | Miscanthus Phyllosphere | SFACFGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQVGLMNLQVFVL* |
Ga0182140_10264012 | 3300015314 | Miscanthus Phyllosphere | VINHQKGGDCKENGPWAHLLWILVLNDQHNQIGLMNLQVFVL* |
Ga0182140_10373951 | 3300015314 | Miscanthus Phyllosphere | GDCKENGPLVHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182136_10236572 | 3300015317 | Switchgrass Phyllosphere | GRVVIKHQKGGDCKENGPRPILVWILVFDDQQDQIGLICLQVFVL* |
Ga0182127_10665571 | 3300015321 | Miscanthus Phyllosphere | HCKENGPLAHLLWILVFDDQHNQIGLMNLQVIIL* |
Ga0182127_10707701 | 3300015321 | Miscanthus Phyllosphere | FIWYILLFSYLGHVLINHQNRRDCKENGPLAHLVWILVFDVQHDHLN* |
Ga0182127_10718461 | 3300015321 | Miscanthus Phyllosphere | DCKENGSLTHLLWILVFDDQHNQIRLMNLQVIIL* |
Ga0182110_10836541 | 3300015322 | Miscanthus Phyllosphere | LLGFGRVVINHQKWGDCKENGPQAQLLWILVFDDQHNQIGLMDLQVIVL* |
Ga0182187_10845141 | 3300015341 | Miscanthus Phyllosphere | LLFACFGHVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMN |
Ga0182187_11980762 | 3300015341 | Miscanthus Phyllosphere | FGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGQMNLQVVVL* |
Ga0182155_11360551 | 3300015343 | Miscanthus Phyllosphere | INHQKGGDCKENGPLTHLLWILVFDDQHNQIGLMNLQVFVL* |
Ga0182189_11542571 | 3300015344 | Miscanthus Phyllosphere | QKGGDCKENGPLAHLLWILVFDVQHNQIGLMNLQVFVL* |
Ga0182111_11002241 | 3300015345 | Miscanthus Phyllosphere | TMDYLVCKENGPLAHLLWILVFDDQHNQIRLMNVQVIIL* |
Ga0182111_11122861 | 3300015345 | Miscanthus Phyllosphere | ACFGRVGINHQKGGDCKENGPLAHLLWILVFDVQHNQIGLMNLQVSIL* |
Ga0182111_11174731 | 3300015345 | Miscanthus Phyllosphere | NHQKGGDCKKNGPSAHLLWILVFDDQHNQIGLMNLQVVVL* |
Ga0182139_11395881 | 3300015346 | Miscanthus Phyllosphere | NHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMKLQVIVL* |
Ga0182139_12001241 | 3300015346 | Miscanthus Phyllosphere | KFSLFACFGRVVINHQKGGDCKENGPYDHLLWILVFDDQHNQIGVMNLQVICFVV* |
Ga0182177_10721111 | 3300015347 | Miscanthus Phyllosphere | MHQKGGDCKENEPLAHLVWILVFDDQHDQVGLIYLQVFIFSTG |
Ga0182177_12448201 | 3300015347 | Miscanthus Phyllosphere | GGDCKENGPLAHLVWILVFDDQHNQIGLISLQVFVL* |
Ga0182161_10801281 | 3300015351 | Miscanthus Phyllosphere | KGGDCKENGPLTHLLWILVFDDQHYQIGLTNLQVIVL* |
Ga0182161_11538981 | 3300015351 | Miscanthus Phyllosphere | MLLFACFGHFVINHQKGEDCKENGPLAHLLWILVFDDQHNQIVLMILQVFVL* |
Ga0182161_12131441 | 3300015351 | Miscanthus Phyllosphere | SFACFGRVVINRQKGGDCKENGPLADLHWILVFEDQLDQIGLMCLRVLVL* |
Ga0182161_12157231 | 3300015351 | Miscanthus Phyllosphere | FACFGRVGINHQKGGDCKENGPLAHLLWILVFDAQHNQIGLMNLQVIVL* |
Ga0182159_11905181 | 3300015355 | Miscanthus Phyllosphere | NHQKGEDCKENGPLAHLVWILVFDDQQDQIGLMDLQVFIF* |
Ga0182203_10605981 | 3300017404 | Miscanthus Phyllosphere | HQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Ga0182203_11630131 | 3300017404 | Miscanthus Phyllosphere | LLNLKFLLFTCFGRVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFV |
Ga0182204_11180001 | 3300017409 | Miscanthus Phyllosphere | VVINHQKGGDCKKNGPLAHLLWILVFDDQYNQIGLMNLQVTVL |
Ga0182207_10486862 | 3300017410 | Miscanthus Phyllosphere | TSFCKENGPLAHLVWILLFDDQQDQIRLMCLQVVAL |
Ga0182207_11748391 | 3300017410 | Miscanthus Phyllosphere | ILKFLLFACFDRVVINHQKGGDCKENRPYAHLFCILVFDDQHNQIRLINSKVIVL |
Ga0182208_11218741 | 3300017411 | Miscanthus Phyllosphere | LLFACFGHVGINHQKGGDYKENGPLAHLLWILVFDDQ |
Ga0182222_10518541 | 3300017413 | Miscanthus Phyllosphere | FGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIRLMNLQVFIL |
Ga0182222_10635911 | 3300017413 | Miscanthus Phyllosphere | ACFGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLINLQVIVL |
Ga0182228_11047351 | 3300017420 | Miscanthus Phyllosphere | GDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Ga0182219_10381901 | 3300017424 | Miscanthus Phyllosphere | QKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Ga0182224_10475622 | 3300017425 | Miscanthus Phyllosphere | AQGSCKENGPLAHLLWILVFDDQHNQIGLIKLQVIVS |
Ga0182190_10605672 | 3300017427 | Miscanthus Phyllosphere | MHKKGGDCKENGPLAHLLSILVFDDQHNQIALMNLQVIVL |
Ga0182192_11111091 | 3300017430 | Miscanthus Phyllosphere | VWHMIDACKENGPKAHLLSILVFDDQHNQIGLMNLQVIVL |
Ga0182209_10963642 | 3300017436 | Miscanthus Phyllosphere | VVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNFASVCFVVQ |
Ga0182209_11070931 | 3300017436 | Miscanthus Phyllosphere | LLFACFGHVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLM |
Ga0182209_11300912 | 3300017436 | Miscanthus Phyllosphere | MILIWYLLLFACFGHVVIKHQKGVDCKENRQSAHLLWILVFDEQEDQSGLMCLQVFVL |
Ga0182209_11603821 | 3300017436 | Miscanthus Phyllosphere | ACFGRVVINHQKEGGCKENGPLAYLLWILVFDDQQDQIGLIFLRVLVL |
Ga0182191_10969792 | 3300017438 | Miscanthus Phyllosphere | GINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Ga0182191_11223691 | 3300017438 | Miscanthus Phyllosphere | INHQKGGDCKENGPLAHLLWILVFDDQYNQIGLMNLQVIVL |
Ga0182191_11350831 | 3300017438 | Miscanthus Phyllosphere | FGRVGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFAL |
Ga0182191_11480981 | 3300017438 | Miscanthus Phyllosphere | TICKENGPSVHLVWILVFDDQHDQIGLMNLQLFIL |
Ga0182221_10451621 | 3300017442 | Miscanthus Phyllosphere | HQKGGDCKENGPLAHLLWILVFDVQHNQIGLMNLQVFVL |
Ga0182193_10232521 | 3300017443 | Miscanthus Phyllosphere | HQAKKGRDCKENRPFAHLVWILVFDDQHDQVGLICLQVFIL |
Ga0182193_11713041 | 3300017443 | Miscanthus Phyllosphere | CFGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVIVL |
Ga0182233_10970971 | 3300017680 | Miscanthus Phyllosphere | VGINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Ga0182229_10664011 | 3300017682 | Miscanthus Phyllosphere | KGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
Ga0182218_11011521 | 3300017683 | Miscanthus Phyllosphere | LPFALHPTSREFLNSKFLLFACFGCVVINHKKGGDCKENGPLAHLLWILVFNDQHNQIGLMNLQVIVL |
Ga0182225_10393611 | 3300017684 | Miscanthus Phyllosphere | FACFGRVVINHQKGGDCKENGPKAHLLWILVFDDQHNQVGLMNLQVIVL |
Ga0182205_10955042 | 3300017686 | Miscanthus Phyllosphere | ACFGRVVINHQKWEDCKENGPLAHLLWILVFDDQHNQIGLMNLQVIVL |
Ga0182205_11003622 | 3300017686 | Miscanthus Phyllosphere | FGRVVINHQKGGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFIL |
Ga0182205_11025571 | 3300017686 | Miscanthus Phyllosphere | LLFACFGHVGINHQKGGDYKENGPLAHLLWILVFDDQHNQIGLMNL |
Ga0182205_11600251 | 3300017686 | Miscanthus Phyllosphere | QKGGDCKENGPLAHLLWILVFDDQHNQIGLINLQVIVL |
Ga0207689_102168103 | 3300025942 | Miscanthus Rhizosphere | NHQKGGDCKENDPLAHLLWILVFDDQHNQIGLINLQVFVL |
Ga0207689_115714591 | 3300025942 | Miscanthus Rhizosphere | LLFACFGRVGINHQKGGDCKENGPLAHLLWILVFDGQHNQIGLMNLQVFVL |
Ga0207648_101645744 | 3300026089 | Miscanthus Rhizosphere | GGDCKENGPLAHLLWILVFDDQHNQIGLMNLQVFVL |
⦗Top⦘ |