NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F085198

Metagenome / Metatranscriptome Family F085198

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085198
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 213 residues
Representative Sequence SNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHS
Number of Associated Samples 93
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.90 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(81.982 % of family members)
Environment Ontology (ENVO) Unclassified
(60.360 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(95.495 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.70%    β-sheet: 24.20%    Coil/Unstructured: 62.10%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004800|Ga0058861_10971476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens626Open in IMG/M
3300007241|Ga0075170_1439434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens585Open in IMG/M
3300012469|Ga0150984_113060414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens715Open in IMG/M
3300021855|Ga0213854_1296955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens697Open in IMG/M
3300029659|Ga0206094_119536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens565Open in IMG/M
3300030526|Ga0210267_1009932All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens541Open in IMG/M
3300030528|Ga0210277_10110124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens528Open in IMG/M
3300030531|Ga0210274_1454508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens638Open in IMG/M
3300030535|Ga0210285_1045631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens562Open in IMG/M
3300030535|Ga0210285_1457085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens640Open in IMG/M
3300030539|Ga0210281_1328758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens513Open in IMG/M
3300030539|Ga0210281_1414482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens517Open in IMG/M
3300030542|Ga0210249_1163917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens664Open in IMG/M
3300030542|Ga0210249_1165298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens686Open in IMG/M
3300030543|Ga0210289_1622060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens661Open in IMG/M
3300030545|Ga0210271_10389212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens688Open in IMG/M
3300030547|Ga0247656_1187610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens548Open in IMG/M
3300030548|Ga0210252_10943612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens686Open in IMG/M
3300030549|Ga0210257_10215483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens624Open in IMG/M
3300030551|Ga0247638_1073782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens715Open in IMG/M
3300030563|Ga0247653_1031233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens653Open in IMG/M
3300030564|Ga0210256_10555485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens689Open in IMG/M
3300030564|Ga0210256_10643067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens684Open in IMG/M
3300030566|Ga0257186_1060854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens703Open in IMG/M
3300030572|Ga0210258_10533248All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens688Open in IMG/M
3300030573|Ga0210272_1196017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens593Open in IMG/M
3300030578|Ga0210275_10191963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens649Open in IMG/M
3300030581|Ga0210270_1331941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens659Open in IMG/M
3300030586|Ga0265393_1117977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens623Open in IMG/M
3300030588|Ga0210283_1019550All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens680Open in IMG/M
3300030591|Ga0247626_1118795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens691Open in IMG/M
3300030593|Ga0210263_1133743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens596Open in IMG/M
3300030594|Ga0210280_1071652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens681Open in IMG/M
3300030595|Ga0210276_10885280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens539Open in IMG/M
3300030596|Ga0210278_1081676All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens692Open in IMG/M
3300030596|Ga0210278_1095049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens661Open in IMG/M
3300030597|Ga0210286_1146156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens673Open in IMG/M
3300030598|Ga0210287_1117941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens661Open in IMG/M
3300030602|Ga0210254_10186446All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens684Open in IMG/M
3300030602|Ga0210254_10659514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens693Open in IMG/M
3300030603|Ga0210253_10030555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens688Open in IMG/M
3300030604|Ga0247637_1061496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens732Open in IMG/M
3300030605|Ga0210265_1169269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens510Open in IMG/M
3300030609|Ga0247634_10355632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens602Open in IMG/M
3300030610|Ga0247613_10224761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens672Open in IMG/M
3300030622|Ga0265391_10119466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens700Open in IMG/M
3300030622|Ga0265391_10146406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens663Open in IMG/M
3300030623|Ga0265392_1079471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens708Open in IMG/M
3300030624|Ga0210251_10163958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens710Open in IMG/M
3300030624|Ga0210251_10826350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens667Open in IMG/M
3300030625|Ga0210259_10724506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens684Open in IMG/M
3300030626|Ga0210291_11138715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens692Open in IMG/M
3300030626|Ga0210291_11776732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens689Open in IMG/M
3300030627|Ga0210269_10162594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens695Open in IMG/M
3300030627|Ga0210269_10172117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens682Open in IMG/M
3300030631|Ga0210279_10208353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens700Open in IMG/M
3300030635|Ga0247627_10147045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens674Open in IMG/M
3300030738|Ga0265462_10942998All Organisms → cellular organisms → Eukaryota731Open in IMG/M
3300030738|Ga0265462_11381999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens645Open in IMG/M
3300030740|Ga0265460_11265781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens713Open in IMG/M
3300030740|Ga0265460_11767058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens632Open in IMG/M
3300030741|Ga0265459_11964644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens698Open in IMG/M
3300030741|Ga0265459_12818305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens605Open in IMG/M
3300030743|Ga0265461_11677276All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens702Open in IMG/M
3300030775|Ga0074021_1565524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens666Open in IMG/M
3300030777|Ga0075402_10198815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens666Open in IMG/M
3300030778|Ga0075398_10061848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens595Open in IMG/M
3300030804|Ga0102769_11048978All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens652Open in IMG/M
3300030845|Ga0075397_11045772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens663Open in IMG/M
3300030847|Ga0075405_12208523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens525Open in IMG/M
3300030848|Ga0075388_11491967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens571Open in IMG/M
3300030852|Ga0075389_11234370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens659Open in IMG/M
3300030853|Ga0075372_11349136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens670Open in IMG/M
3300030909|Ga0074033_10811257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens573Open in IMG/M
3300030923|Ga0138296_1126456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens679Open in IMG/M
3300030923|Ga0138296_1811278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens708Open in IMG/M
3300030933|Ga0074039_11570433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens671Open in IMG/M
3300030934|Ga0075391_11392575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens664Open in IMG/M
3300030935|Ga0075401_11668333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens537Open in IMG/M
3300030936|Ga0138306_1322441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens601Open in IMG/M
3300030937|Ga0138302_1364950All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens665Open in IMG/M
3300030938|Ga0138299_10726958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens677Open in IMG/M
3300030939|Ga0138303_1369941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens646Open in IMG/M
3300030962|Ga0138297_1324242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens670Open in IMG/M
3300030971|Ga0075375_10091394All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens674Open in IMG/M
3300030974|Ga0075371_10062379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens656Open in IMG/M
3300030979|Ga0068589_10005399All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens695Open in IMG/M
3300030980|Ga0074027_11083710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens801Open in IMG/M
3300030992|Ga0074040_11042535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens597Open in IMG/M
3300030999|Ga0074019_10077597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens618Open in IMG/M
3300031008|Ga0074038_11760271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens665Open in IMG/M
3300031015|Ga0138298_1097826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens668Open in IMG/M
3300031015|Ga0138298_1671344All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens510Open in IMG/M
3300031029|Ga0074012_11278385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens662Open in IMG/M
3300031031|Ga0074042_11312151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens664Open in IMG/M
3300031034|Ga0074041_11118574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens674Open in IMG/M
3300031053|Ga0074018_1450238All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens646Open in IMG/M
3300031057|Ga0170834_107835493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens526Open in IMG/M
3300031122|Ga0170822_13778474All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens696Open in IMG/M
3300031122|Ga0170822_13874751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens520Open in IMG/M
3300031231|Ga0170824_127521000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens660Open in IMG/M
3300031469|Ga0170819_12141124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens681Open in IMG/M
3300031469|Ga0170819_16569812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens575Open in IMG/M
3300031474|Ga0170818_103085353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens676Open in IMG/M
3300031481|Ga0314816_1034228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens656Open in IMG/M
3300031495|Ga0314817_120692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens583Open in IMG/M
3300032739|Ga0315741_11260546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens662Open in IMG/M
3300032756|Ga0315742_11859586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens664Open in IMG/M
3300034363|Ga0326787_040028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens663Open in IMG/M
3300034363|Ga0326787_046691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens621Open in IMG/M
3300034771|Ga0326771_055944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Coluteocarpeae → Noccaea → Noccaea caerulescens516Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil81.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil8.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.70%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.80%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.80%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.90%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.90%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300007241Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300021855Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029659Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030526Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030542Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030563Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030566Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030610Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030804Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030845Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030936Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030971Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030992Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030999Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031053Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031481Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031495Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300034363Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S96 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034771Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058861_1097147613300004800Host-AssociatedNLLAVSAQRESVGSFPVSPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHC
Ga0075170_143943413300007241Wastewater EffluentQSIDSFPLSSSGWTILCIFGATTVETTVLLADRGETTELTVFVDRVHNPVDFGVTADSFMGRIYKDDFIVFVGGILHNPVGAQHSQVTSTTTNSLLGNRLVRSLEFELVDTSAGGFTVVDTLGQRLLAPTSTNTDTVDHVTLLGLVAQTTGLVRSSGVGYAVNGREVSVFPASKPEQSPQNVRLLLLVKFLKIFV
Ga0150984_11306041413300012469Avena Fatua RhizosphereVCPPGWTVLCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVVGINEDDFVVFVSRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLVTKTASLVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKLFKIF
Ga0213854_129695513300021855WatershedsLFSYIAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRSMRALEFELVDTSTSGFAVVDTLGQRLLAPSSSNTDTVDHITLLRLVAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCSPPEK
Ga0206094_11953613300029659SoilVLCIFRTTTVETTVLLANRGKTSELTVFVDGVHNPVDFGVTTDGFVGGVDQDDFIVFVGGILHNPVGAQDTQVTSTTANSLLSNRLVGSLEFELVNTSAGGFTVVDTLGQRLLASSSSNTDTVDHVTLLGFEAEATSLVRSSWVGNSVNGREISVFPASKPEQSPQNVRLLLLVKLLKIFVGTHCSPR
Ga0210267_100993213300030526SoilLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRIDKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRRRGRGKFGKVFV
Ga0210277_1011012413300030528SoilNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSW
Ga0210274_145450813300030531SoilSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSP
Ga0210285_104563113300030535SoilTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGK
Ga0210285_145708513300030535SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFV
Ga0210281_132875813300030539SoilSNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSATPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTT
Ga0210281_141448213300030539SoilLAVSAQRESVGSFPVRPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVRGINEDDFVVFVSRILHNPIGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLVTKTASLVRSSGVGDTVNG
Ga0210249_116391713300030542SoilSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINNNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTH
Ga0210249_116529813300030542SoilSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVK
Ga0210289_162206013300030543SoilSNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHS
Ga0210271_1038921213300030545SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKRD
Ga0247656_118761013300030547SoilSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSV
Ga0210252_1094361213300030548SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKR
Ga0210257_1021548313300030549SoilLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTN
Ga0247638_107378213300030551SoilFFFFFFSYIAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSPPEKGK
Ga0247653_103123313300030563SoilKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVLPASKPEQSPQDVRLLLLVKFLKIFV
Ga0210256_1055548513300030564SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVK
Ga0210256_1064306713300030564SoilNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKR
Ga0257186_106085413300030566Host-AssociatedFFFFSSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASSSSNPDTVENESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGKK
Ga0210258_1053324813300030572SoilTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGK
Ga0210272_119601713300030573SoilNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLV
Ga0210275_1019196313300030578SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTH
Ga0210270_133194113300030581SoilTSNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTH
Ga0265393_111797713300030586SoilGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFKLVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGKR
Ga0210283_101955013300030588SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNPPVKGKK
Ga0247626_111879513300030591SoilAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSPPEKGKR
Ga0210263_113374313300030593SoilSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFL
Ga0210280_107165213300030594SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKR
Ga0210276_1088528013300030595SoilAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSAGGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSE
Ga0210278_108167613300030596SoilSYIAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGRTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINEDDFVVFVGRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLVAKTASLVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCSPPEK
Ga0210278_109504913300030596SoilKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNPPVKGKR
Ga0210286_114615613300030597SoilLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGKK
Ga0210287_111794113300030598SoilRTSNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTH
Ga0210254_1018644613300030602SoilNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKR
Ga0210254_1065951413300030602SoilSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGK
Ga0210253_1003055513300030603SoilTINLFLFLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGK
Ga0247637_106149613300030604SoilRVPFGSRVFFFFFAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSPPEKGKRE
Ga0210265_116926913300030605SoilTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNPPVKGKRE
Ga0247634_1035563213300030609SoilSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREVSVFPASKPEQSPQ
Ga0247613_1022476113300030610SoilAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSP
Ga0265391_1011946613300030622SoilSDFFFFFFLTSNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNP
Ga0265391_1014640613300030622SoilSYIAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGRTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINEDDFVVFVGRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSWFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLVAKTASLVRSSGVGDTVNGREISVFPASKPEQSPQNIKLLLLVKFLKIF
Ga0265392_107947113300030623SoilFFFFFFLTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGK
Ga0210251_1016395813300030624SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKREKRVAKEA
Ga0210251_1082635013300030624SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTH
Ga0210259_1072450613300030625SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGK
Ga0210291_1113871513300030626SoilFLTINLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNPPVKGK
Ga0210291_1177673213300030626SoilTSNLFLLLSKSRNLLAVSAQRESVGSFPVRPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVRGINEDDFVVFVSRILHNPIGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLVAKTASLVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCSPPEKGKRE
Ga0210269_1016259413300030627SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGK
Ga0210269_1017211713300030627SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGKRE
Ga0210279_1020835313300030631SoilFFFLTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKR
Ga0247627_1014704513300030635SoilFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVKTTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSPPEKGKR
Ga0265462_1094299813300030738SoilAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNPPVNFTRKSSLMF
Ga0265462_1138199913300030738SoilMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKF
Ga0265460_1126578113300030740SoilFFFFFFLTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTNPPVKGKRE
Ga0265460_1176705813300030740SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKF
Ga0265459_1196464413300030741SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGKR
Ga0265459_1281830513300030741SoilLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKREKRVAKEA
Ga0265461_1167727613300030743SoilFFFLTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSPPVKGKRD
Ga0074021_156552413300030775SoilNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSP
Ga0075402_1019881513300030777SoilAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVSPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTH
Ga0075398_1006184813300030778SoilLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTVLCVFGTTTAETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVGGINKDDFVIFVGRILHNPIGAQDTQVTSTTANSLLRNRLMRSLEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLETKTASLVRSSGVGDTVNGREISVFPASKPEQSPQ
Ga0102769_1104897813300030804SoilLLLSKSSNLLAISAQRQGIDSFPVCPSGWTVLLMVGSTTIETSVLLSSRGETSELTMFVDGVHNPVDFRVSADGFVGRINKNDFKIFVGRILNNPIRVQNAQITSSTPNAFLCDRLKRSLEFELVNSSRSGFAVVDTLGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPTSQSEQSPQNIRLLFLVKFFKVFVGTHCT
Ga0075397_1104577213300030845SoilLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLEAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCSPPEK
Ga0075405_1220852313300030847SoilFPVCPSGWTVLCVFGTTTAETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVGGINKDDFVIFVGRILHNPIGAQDTQVTSTTANSLLRNRLMRSLEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLETKTASLVRSSGVGDTVNGREISVFPASKPEQSPQ
Ga0075388_1149196713300030848SoilLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVVGINEDDFVVFVSRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVALFSLVAQTTSFVRAGRSRSSVNRGQLSVLPA
Ga0075389_1123437013300030852SoilTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLEAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTH
Ga0075372_1134913613300030853SoilAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLEAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCS
Ga0074033_1081125713300030909SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGETSELTVFVDGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETKTTSLIRSSWMRNSMDGREVSVFP
Ga0138296_112645613300030923SoilAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTVLCVFGTTTAETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVVGINEDDFVVFVSRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSANTDTVDHITLLRLVTNTASLVRSSGMGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCSPPE
Ga0138296_181127813300030923SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKGKREKR
Ga0074039_1157043313300030933SoilTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSP
Ga0075391_1139257513300030934SoilAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLEAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTH
Ga0075401_1166833313300030935SoilTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVVGINEDDFVVFVSRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSANADTVDHITLLRLVTNTASLVRSSG
Ga0138306_132244113300030936SoilNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQ
Ga0138302_136495013300030937SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGT
Ga0138299_1072695813300030938SoilNLFLLLSKPSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVKG
Ga0138303_136994113300030939SoilFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGT
Ga0138297_132424213300030962SoilFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTSPPVK
Ga0075375_1009139413300030971SoilAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVVGINEDDFVVFVSRILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLVTKTASLVRSSGVGDTVNGREISVFPASKPEQSPQDIRLLLLVKFLKIFVGTHCSP
Ga0075371_1006237913300030974SoilAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLEAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFV
Ga0068589_1000539913300030979SoilIAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTVLCVFGTTTAETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVGGINKDDFVIFVGRILHNPIGAQDTQVTSTTANSLLRNRLMRSLEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLETKTASLVRSSGVGDTVNGREISVFPASKPEQSPQDIRLLLLVKFLKIFVGTHCSPPEKGKR
Ga0074027_1108371013300030980SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSDIATALVIDHVLEVASTDADIGGSVVAVASVGGALIAGDLH
Ga0074040_1104253513300030992SoilRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSE
Ga0074019_1007759713300030999SoilSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLF
Ga0074038_1176027113300031008SoilRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHC
Ga0138298_109782613300031015SoilSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRINQDDFVVFIGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHC
Ga0138298_167134413300031015SoilGTSILFLLLSKSRSLLAVSAQRQGIDSFPVCPSGWSVLCMIGTTTVETTVLLSNSSEASEFAMFVDGVHNPVNFGVSTNGFVGRIDEDDFIVFVGGVLHNPVRAQNAQIASPTTNSFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHISLLGLETK
Ga0074012_1127838513300031029SoilTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIQTSVLLSSRGETSELTVFVDGVHNPVDFRVSADGFVGRINQDDFEVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASSSSNPDTVENESLLGLETKTTSLIRPSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHC
Ga0074042_1131215113300031031SoilSSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGT
Ga0074041_1111857413300031034SoilSRTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHCTS
Ga0074018_145023813300031053SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGT
Ga0170834_10783549313300031057Forest SoilNTGTSILFLLLSKSRSLLAVSAQRQGIDSFPVCPSGWSVLCMIGTTTVETTVLLSNSSEASEFAMFVDGVHNPVNFGVSTNGFVGRIDEDDFIVFVGGVLHNPVRAQNAQIASPTTNSFLRNRLKRSLEFELVDTSTGGFTVVDTLGQRLLATTSSNTDTVDHVTLLGLVTKTT
Ga0170822_1377847413300031122Forest SoilIAKTSNLFLLLSKSRNLLAVSAQRESVDSFPVCPSGWTILCVFGTTTVETTVLLASRGKTTELTVFVDGVHNPVDFGVSADSFVVGINENNFVVFVGRILHNPVGAQDSQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLEAKTASFVRSSGVGDTVNGREISVFPASKPEQSPQNVRLLLLVKFLKIFVGTHCSPPEKGKRA
Ga0170822_1387475113300031122Forest SoilGTSILFLLLSKSRSLLAVSAQRQGIDSFPVCPSGWSVLCMIGTTTVETTVLLSNSSEASEFAMFVDGVHNPVNFGVSTNGFVGRIDEDDFIVFVGGVLHNPVRAQNAQIASPTTNSFLRNRLKRSLEFELVDTSTGGFTVVDTLGQRLLATTSSNTDTVDHVTLLGLVTKTT
Ga0170824_12752100013300031231Forest SoilAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVCPSGWTVLCVFGTTTAETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVGGINKDDFVIFVGRILHNPIGAQDTQVTSTTANSLLRNRLMRSLEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLETKTASLVRSSGVGDTVNGREIAVFPASKPEQSPQNVRLLLLVKFLKIFVGT
Ga0170819_1214112413300031469Forest SoilYIAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVSPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDSVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSPP
Ga0170819_1656981213300031469Forest SoilPSGWTVLCVFGTTTAETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANCFVGGINKDDFVIFVGRILHNPIGAQDTQVTSTTANSLLRNRLMRSLEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHVTLLRLETKTASLVRSSGVGDTVNGREISVFPASKPEQSPQDIRLLLLVKFLKIFVGTHCS
Ga0170818_10308535313300031474Forest SoilIAKTSNLFLLLSKSRNLLAVSAQRESVGSFPVSPSGWTILCVFGTTTVETTVLLASRGKTTEFTVFVDGVHNPVDFGVSANSFVRGINKDDFVVFVGGILHNPVGAQDTQVTSTTANSLLRNRLMRALEFELVDTSTSGFTVVDTLGQRLLAPSSSNTDTVDHITLLRLVTNTASLVRSSGVRDTVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCSP
Ga0314816_103422813300031481SoilILLLSKSSNLLAVSAQRQSVDSFPVCPSGWTILCVFGTTTVETTVLLANRGETSEFTVFVDGVHNPVDFGVTTDGFVGGVDQDDFIVFVGRILHNPVRAQDTQVTSTTANSLLSNRLVGSLEFELVNTSAGGFTIVDTLGQRLLASSSTNTDTVDHVALLGFVAQATSLVRSSWVGNSVNGREVSVFPASKPEQSPQNVRLLLLVKLFKIFVGTHCSP
Ga0314817_12069213300031495SoilQRQSVDSFPVCPSGWTILCVFGTTTVETTVLLANRGETSEFTVFVDGVHNPVDFGVTTDGFVGGVDQDDFIVFVGRILHNPVRAQDTQVTSTTANSLLSNRLVGSLEFELVNTSAGGFTIVDTLGQRLLASSSTNTDTVDHVALLGFVAQATSLVRSSWVGNSVNGREVSVFPASKPEQSPQNVRLLLLVKLFM
Ga0315741_1126054613300032739Forest SoilLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTVLCMIGPTTIETSVLLSSRGETSELTMFVDGFHNPVDFRVSADGFVGRINKNDFKIFVGGILNNPIRVQNAQITSSTPNAFLRNRLKRSLEFELINSSRSGFAVVDTFGQRLLASSSSNTDTVDHVSLLGLETKTTSLIRSSWMRNSMDGREVSVFPASQSEQSPQNIRLLFLVKFFKVFVGTHSTSP
Ga0315742_1185958613300032756Forest SoilTSNLFLLLSKSSNLLAVSAQRQGIDSFPVCPSGWTILCVLGTTTIETSVLLSSRGKTSELTVFVYGVHNPVDFRVSADGFVGRVNQDDFVVFVGGVLDKPIRAQNAQISSSTPNAFFRNRLKGSLEFELVNTSRSGFAVVDTLGQRLLASTSSNPDTVDHESLLGLETKTTSLIRSSWVRNSMDGREISVFPASQSEQSPQNIRLLFLVKFFKVFVGTHC
Ga0326787_040028_81_6623300034363SoilVCPSGWTILCIFGTTTVQTTVLLANRGETTEFTVFVDGVDNPVDLGVSANGLVGRINEDDFIVFVGGVLHNPVGAQDTQVTSTTTNSLLRNRLMRSLEFELVDTSASGFAVVDTLGQRLLASSSSNTDTVDHVALLGLETKTASLIRSSGMGDSVNGREVSVFPASKPEQSPQNIRLLLLVKFLKIFVGTPCSP
Ga0326787_046691_41_6193300034363SoilLRPSGWTILCVFGTTTVETTVLLANTGETTELTVFVDGVHDPVDFGVSANGFVGGIDEDNFVIFVGGVLHNPVGAQDTQVTSTTANSLLRNRSMRALEFELVDTSTSGFTVVNTLGQRLLAPSSSNTDTVDHVTLLRLVAKTASLVRSSGVGDTVNGREISVFPASKPEQSPQDVRLLLLVKFLKIFVGTHCS
Ga0326771_055944_3_5153300034771SoilQRKSIDSFPVCPSGWTILCIFGTTTVQTTVLLANRGETTEFTVFVDGVDNPVDLGVSANGLVGRINEDDFIVFVGGVLHNPVGAQDTQVTSTTTNSLLRNRLMRSLEFELVDTSASGFAVVDTLGQRLLASSSSNTDTVDHVALLGLETKTASLIRSSGMGDSVNGREVSV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.