Basic Information | |
---|---|
Family ID | F084565 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 45 residues |
Representative Sequence | RRMALTGVNKRVLKVFEITKVEQIFLMFPTLSDAIEAFTNAGTA |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.11 % |
% of genes from short scaffolds (< 2000 bps) | 90.18 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.750 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (12.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.214 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.893 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF08002 | DUF1697 | 16.07 |
PF01750 | HycI | 8.04 |
PF12900 | Pyridox_ox_2 | 5.36 |
PF00374 | NiFeSe_Hases | 2.68 |
PF05721 | PhyH | 1.79 |
PF12704 | MacB_PCD | 0.89 |
PF00749 | tRNA-synt_1c | 0.89 |
PF11645 | PDDEXK_5 | 0.89 |
PF08974 | DUF1877 | 0.89 |
PF00082 | Peptidase_S8 | 0.89 |
PF00107 | ADH_zinc_N | 0.89 |
PF01058 | Oxidored_q6 | 0.89 |
PF13188 | PAS_8 | 0.89 |
PF00460 | Flg_bb_rod | 0.89 |
PF13561 | adh_short_C2 | 0.89 |
PF03950 | tRNA-synt_1c_C | 0.89 |
PF00202 | Aminotran_3 | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 16.07 |
COG0680 | Ni,Fe-hydrogenase maturation factor | Energy production and conversion [C] | 8.04 |
COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 2.68 |
COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 2.68 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.79 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.79 |
COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.89 |
COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.89 |
COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 0.89 |
COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.89 |
COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.89 |
COG1815 | Flagellar basal body rod protein FlgB | Cell motility [N] | 0.89 |
COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.89 |
COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.89 |
COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 0.89 |
COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.75 % |
Unclassified | root | N/A | 6.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12126137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300001356|JGI12269J14319_10234050 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300001546|JGI12659J15293_10003660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4620 | Open in IMG/M |
3300004091|Ga0062387_100353199 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300004267|Ga0066396_10084876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300005175|Ga0066673_10203602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1130 | Open in IMG/M |
3300005186|Ga0066676_10259675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
3300005437|Ga0070710_10422598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
3300005439|Ga0070711_101144417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300005445|Ga0070708_101711223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300005447|Ga0066689_10634594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300005532|Ga0070739_10130116 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300005542|Ga0070732_10547838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300005712|Ga0070764_10019367 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
3300005887|Ga0075292_1031283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300006086|Ga0075019_10860571 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300006102|Ga0075015_100027118 | All Organisms → cellular organisms → Bacteria | 2584 | Open in IMG/M |
3300006174|Ga0075014_100860768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300006175|Ga0070712_100674678 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300006176|Ga0070765_100345361 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300006176|Ga0070765_100353037 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300006176|Ga0070765_100598437 | Not Available | 1039 | Open in IMG/M |
3300006358|Ga0068871_102290955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300006806|Ga0079220_11393021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300007788|Ga0099795_10102771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
3300009520|Ga0116214_1105060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
3300009638|Ga0116113_1130426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300009638|Ga0116113_1147570 | Not Available | 588 | Open in IMG/M |
3300009698|Ga0116216_10698095 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300009700|Ga0116217_10717264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 618 | Open in IMG/M |
3300009824|Ga0116219_10562339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 628 | Open in IMG/M |
3300010046|Ga0126384_12232168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300010048|Ga0126373_10256997 | Not Available | 1722 | Open in IMG/M |
3300010376|Ga0126381_103431252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
3300010379|Ga0136449_102179658 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300011082|Ga0138526_1124344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300011120|Ga0150983_11813215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300011120|Ga0150983_12228574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300012207|Ga0137381_10937434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300012971|Ga0126369_12847481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300013296|Ga0157374_12295604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300014166|Ga0134079_10557477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300014167|Ga0181528_10880511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300014654|Ga0181525_10103063 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300017936|Ga0187821_10116206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
3300017943|Ga0187819_10440250 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300017955|Ga0187817_10278960 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300017973|Ga0187780_10034820 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
3300018023|Ga0187889_10267973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
3300018058|Ga0187766_10278443 | Not Available | 1078 | Open in IMG/M |
3300018064|Ga0187773_10568878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300018085|Ga0187772_10018618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3949 | Open in IMG/M |
3300018085|Ga0187772_10491613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
3300018482|Ga0066669_11047983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300020062|Ga0193724_1064796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300020580|Ga0210403_10714380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300021181|Ga0210388_10291798 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300021420|Ga0210394_11555452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300021433|Ga0210391_10292541 | Not Available | 1278 | Open in IMG/M |
3300021475|Ga0210392_10902334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300021477|Ga0210398_10420606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
3300021478|Ga0210402_10795021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300021560|Ga0126371_10021983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5895 | Open in IMG/M |
3300022523|Ga0242663_1055296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300022716|Ga0242673_1082836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300025914|Ga0207671_11504375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300025916|Ga0207663_10097837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1963 | Open in IMG/M |
3300025928|Ga0207700_10296442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1395 | Open in IMG/M |
3300025939|Ga0207665_10798437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
3300026020|Ga0208531_1020807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300026332|Ga0209803_1301447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300027000|Ga0207803_1044180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300027604|Ga0208324_1188792 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300027812|Ga0209656_10147573 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300027842|Ga0209580_10005136 | All Organisms → cellular organisms → Bacteria | 5575 | Open in IMG/M |
3300027842|Ga0209580_10424973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300027867|Ga0209167_10534906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300027879|Ga0209169_10385679 | Not Available | 737 | Open in IMG/M |
3300027884|Ga0209275_10247290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
3300027889|Ga0209380_10118233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1540 | Open in IMG/M |
3300027911|Ga0209698_10305724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
3300028023|Ga0265357_1012709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300028577|Ga0265318_10363065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300028800|Ga0265338_10566070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300028879|Ga0302229_10328643 | Not Available | 685 | Open in IMG/M |
3300030054|Ga0302182_10161748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
3300030503|Ga0311370_11940090 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300031057|Ga0170834_112892295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
3300031249|Ga0265339_10364320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300031525|Ga0302326_10215654 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
3300031712|Ga0265342_10258793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
3300031718|Ga0307474_11516585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300031719|Ga0306917_11240475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
3300031747|Ga0318502_10976658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300031823|Ga0307478_10002363 | All Organisms → cellular organisms → Bacteria | 14922 | Open in IMG/M |
3300031833|Ga0310917_10684479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300032770|Ga0335085_11861441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300032770|Ga0335085_12539490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300032783|Ga0335079_11390346 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300032805|Ga0335078_11862831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300032805|Ga0335078_12412059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300032892|Ga0335081_12382841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300032896|Ga0335075_11255677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300032897|Ga0335071_10046933 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia sinica | 4266 | Open in IMG/M |
3300032897|Ga0335071_10817017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
3300032897|Ga0335071_11809758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300032898|Ga0335072_10864198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300032955|Ga0335076_10100544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2819 | Open in IMG/M |
3300033134|Ga0335073_12070962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300033158|Ga0335077_11731008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300033433|Ga0326726_11768209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
3300033887|Ga0334790_210143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 12.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.82% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.14% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.46% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.46% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.46% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.68% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.79% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.79% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.79% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026020 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_121261371 | 3300000789 | Soil | RIALTGVNKRVLKVFEITKVEQILLMFPTLSDAIEAFTNAGTA* |
JGI12269J14319_102340501 | 3300001356 | Peatlands Soil | IAITGLNQRVQKVFEITKVENIFLIFPTLSDALEAFTNSGTA* |
JGI12659J15293_100036601 | 3300001546 | Forest Soil | TACTSCAKAGRRMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGSA* |
Ga0062387_1003531993 | 3300004091 | Bog Forest Soil | SCTKAGRRIALTGVNKRVRKVFEITRVEQVFLMFPTLSDALEAFTNAGRA* |
Ga0066396_100848762 | 3300004267 | Tropical Forest Soil | TGVNKRVLKVFEITKVEQIFLMFPTLSDAIEAFTNTGSA* |
Ga0066673_102036021 | 3300005175 | Soil | SACTSAAKAGRRIALAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA* |
Ga0066676_102596754 | 3300005186 | Soil | ALAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA* |
Ga0070710_104225981 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AGRRIAITGVNKRVLKVFEITKVEQILLMFPTLSDAIEAFTNAGTA* |
Ga0070711_1011444173 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVNKRVLKVFEITKVEQILLMFPTLSDAIEAFTNAGTA* |
Ga0070708_1017112232 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA* |
Ga0066689_106345941 | 3300005447 | Soil | GRRVALTGVNQRVMKVFEITKVEEIFLMFPTLSDALEAFTNAGTA* |
Ga0070739_101301163 | 3300005532 | Surface Soil | AAYVSCQKAGRKVALTGVNDKVLKLFEITRVDSVFLMFPTLWEAIEALTGAAQA* |
Ga0070732_105478381 | 3300005542 | Surface Soil | KRVLKVFEITKVEQIFLMFPTLSDAIEAFTNAGSA* |
Ga0070764_100193676 | 3300005712 | Soil | SLVSSCISCQKSGRRMALTGVNQRVMKVFQITKTEPLFLMFPTVSDALEAFTNAGTA* |
Ga0075292_10312833 | 3300005887 | Rice Paddy Soil | KRVLKVFEITKVEQVFLMFPTLSDAIEAFTNAGSA* |
Ga0075019_108605712 | 3300006086 | Watersheds | AYTSCAKSGRRVALTGVNKRVLKVFEITKVERIFLMFPTLSDALEAFTNAGSA* |
Ga0075015_1000271181 | 3300006102 | Watersheds | YTSCAKSGRRVALTGVNKRVLKVFEITKVERIFLMFPTLSDALEAFTNAGTA* |
Ga0075014_1008607682 | 3300006174 | Watersheds | CTSCAKAGRRMALTGVNKRVQKVFEITKVEQVFLMFPTLSDALEAFTNAGTA* |
Ga0070712_1006746783 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | CTSAAKAGRRIALAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA* |
Ga0070765_1003453613 | 3300006176 | Soil | LTGVNKRVRKVFEITKVERIFLMFPTLSDALEAFTNAGTA* |
Ga0070765_1003530372 | 3300006176 | Soil | YVSCQKSGRRMALSGVNPRVWQLFEITKLEPFFLVFPNLMDAIEALTNAGSA* |
Ga0070765_1005984371 | 3300006176 | Soil | NQRVMKVFQITKTEPLFLMFPTVSDALEAFTNAGTA* |
Ga0068871_1022909552 | 3300006358 | Miscanthus Rhizosphere | ATKAGRRIALTGVNKRVLKVFEITKVEQVFLMFPTLSDAIEAFTNAGSA* |
Ga0079220_113930211 | 3300006806 | Agricultural Soil | VSCQKAGRRVALTGVNDRVLKLFEITRVDSVFLMFPTLWEGIEALTGAAQA* |
Ga0099795_101027713 | 3300007788 | Vadose Zone Soil | GINQRVLRVFEITKVEPIFLMFPTVSDALEALTNAGTA* |
Ga0116214_11050601 | 3300009520 | Peatlands Soil | ACTSCAKSGRRMALTGVNKRVQRVFEITKVEQIFLMFPTLSDALEAFTNAGTA* |
Ga0116113_11304261 | 3300009638 | Peatland | AGRRMALTGVNKRVRKVFEITKVEQIFLMFPTLSDALEAFTNAGTA* |
Ga0116113_11475702 | 3300009638 | Peatland | GVNPRVLKVFEITKMEPIFLMFPTISDALEAFTNAGTA* |
Ga0116216_106980951 | 3300009698 | Peatlands Soil | TSCAKSGRRMALTGVNKRVLKVFEITKVEQIFLMFPTLSDALEAFTNAGTA* |
Ga0116217_107172642 | 3300009700 | Peatlands Soil | YTSCAKAGRRIAITGLNQRVQKVFEITKVENIFLIFPTLSDALEAFTNSGTA* |
Ga0116219_105623391 | 3300009824 | Peatlands Soil | GRRIAITGLNQRVQKVFEITKVENIFLIFPTLSDALEAFTNSGTA* |
Ga0126384_122321681 | 3300010046 | Tropical Forest Soil | RVLKVFEITKVERILLMFPTLSDAIEAFTNAGTA* |
Ga0126373_102569972 | 3300010048 | Tropical Forest Soil | RRMALTGVNRRVMKVFEITKTDNVFLMFPTLGDAIEAFTNAGSA* |
Ga0126381_1034312521 | 3300010376 | Tropical Forest Soil | SACTSCTKSGRRMALTGANRRVMKVFEITKTDNVFLMFPTLGDAIEAFTNAGSA* |
Ga0136449_1021796581 | 3300010379 | Peatlands Soil | TGLNQRVQKVFEITKVENIFLIFPTLSDALEAFTNSGTA* |
Ga0138526_11243443 | 3300011082 | Peatlands Soil | CAKSGRRVALTGVNKRVLKVFEITKVERIFLMFPTLSDALEAFTNAGTA* |
Ga0150983_118132151 | 3300011120 | Forest Soil | NKRVRKVFEITKVERIFLMFPTLSDALEAFTNAGTA* |
Ga0150983_122285743 | 3300011120 | Forest Soil | RVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA* |
Ga0137381_109374341 | 3300012207 | Vadose Zone Soil | MALTGVNKRVRKVFEITKMEQIFLIFPTLSDALEAFTNAGTA* |
Ga0126369_128474812 | 3300012971 | Tropical Forest Soil | GRRIALTGVNRRVLKVFEITKVERILLMFPTLSDAIEAFTNAGTA* |
Ga0157374_122956042 | 3300013296 | Miscanthus Rhizosphere | LAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA* |
Ga0134079_105574771 | 3300014166 | Grasslands Soil | SAAKAGRRIALAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA* |
Ga0181528_108805111 | 3300014167 | Bog | TTCTKAGRRIALTGVNKRVLKVFEITRVEQVFLMFPTLTDALEAFTNAGTA* |
Ga0181525_101030631 | 3300014654 | Bog | RVMKVFQITKTEPLFLMFPTVSDALEAFTNAGTA* |
Ga0187821_101162061 | 3300017936 | Freshwater Sediment | KSGRRVALTGVNKRVLKVFEITKVENVFLMFPTLGDAIEALTNAGTA |
Ga0187819_104402501 | 3300017943 | Freshwater Sediment | SCSKAGRRVALIGVNPRVRKVFEITKVENVLLLFPTLADALEALTNAGTA |
Ga0187817_102789603 | 3300017955 | Freshwater Sediment | YTSCAKSGRRVALTGVNKRVLKVFEITKVERIFLMFPTLSDALEAFTNAGTA |
Ga0187780_100348205 | 3300017973 | Tropical Peatland | SAYTSCAKAGRRIAITGVNQRVQKVFEITKVEQVFLIFPTLSDALEAFTNAGTA |
Ga0187889_102679732 | 3300018023 | Peatland | SKAGRRVALTGVNPRVRKVFEITKVENVLLLFPTLADALEALTNAGSA |
Ga0187766_102784431 | 3300018058 | Tropical Peatland | KAGRRIALTGVNQRVQKVFEITKVEQVFLIFPTLSDALEAFTNAGTA |
Ga0187773_105688781 | 3300018064 | Tropical Peatland | KRVLKVFEITKVEQVLLMFPTLADAIEAFTNAGTA |
Ga0187772_100186187 | 3300018085 | Tropical Peatland | GSLVSACTSCTKSGRRMALTGVNKRVLKVLEITKTERVFLMFPTLGDAIEAFTNAGTA |
Ga0187772_104916132 | 3300018085 | Tropical Peatland | LKAGRRVALTGVAPRVMKVFEITKTEPIFLMFPTLSDAIEALTNAGNA |
Ga0066669_110479831 | 3300018482 | Grasslands Soil | SAAKAGRRIALAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA |
Ga0193724_10647961 | 3300020062 | Soil | RMALTGVNKRVRKVFEITKMEQIFLIFPTLSDALEAFTNAGTA |
Ga0210403_107143803 | 3300020580 | Soil | GVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0210388_102917983 | 3300021181 | Soil | SCISCQKSGRRMALTGVNQRVMKVFQITKTEPLFLMFPTLSDALEAFTNAGTA |
Ga0210394_115554521 | 3300021420 | Soil | AKAGRRMALTGVNKRVRKVFEITKVEQIFLMFPTLSDALEAFTNAGTA |
Ga0210391_102925411 | 3300021433 | Soil | ALTGVNQRVMKVFQITKTEPLFLMFPTVSDALEAFTNAGTA |
Ga0210392_109023341 | 3300021475 | Soil | GVNKRVRKVFEITKVEQIFLMFPTLSDALEAFTNAGTA |
Ga0210398_104206063 | 3300021477 | Soil | AKAGRRMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0210402_107950213 | 3300021478 | Soil | CTSCAKSGRRMALTGVNKRVLKVFEITKMEQIFLMFPTLSDALEAFTNAGTA |
Ga0126371_100219831 | 3300021560 | Tropical Forest Soil | KRVLKVFEITKVENILLMFPTLGDAIEAFTNAGTA |
Ga0242663_10552961 | 3300022523 | Soil | ITGVNKRVLKVFEITKVEQILLMFPTLSDAIEAFTNAGTA |
Ga0242673_10828361 | 3300022716 | Soil | RMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGSA |
Ga0207671_115043752 | 3300025914 | Corn Rhizosphere | ALAGVNHRVLKVFEITKVEQIFLMFPTLSDAIEGLTNAGSA |
Ga0207663_100978371 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NKRVRKVFEITKMEQIFLMFPTLSDALEAFTNAGTA |
Ga0207700_102964421 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RIAITGVNKRVLKVFEITKVEQILLMFPTLSDAIEAFTNAGTA |
Ga0207665_107984371 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ACTTCAKAGRRIALTGVNRRVLKVFEITKVEQIFLMFPTLGDAIEALTNAGSA |
Ga0208531_10208072 | 3300026020 | Rice Paddy Soil | KRVLKVFEITKVEQVFLMFPTLSDAIEAFTNAGSA |
Ga0209803_13014471 | 3300026332 | Soil | VNQRVMKVFEITKVEEIFLMFPTLSDALEAFTNAGTA |
Ga0207803_10441802 | 3300027000 | Tropical Forest Soil | TSCAKAGRRIALTGVNKRVLKVFEITKVENILLMFPTLGDAIEAFTNAGTA |
Ga0208324_11887921 | 3300027604 | Peatlands Soil | VNQRVQKVFEITKVENVLLVFPTLADALEAFTNAGTA |
Ga0209656_101475731 | 3300027812 | Bog Forest Soil | NQRVRKVFEITRVEQIFLMFPTLADALEAFTNAGNA |
Ga0209580_100051367 | 3300027842 | Surface Soil | KSGRRMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0209580_104249733 | 3300027842 | Surface Soil | VNKRVMKVLEITKTEKVFLMFPTLGDAIEAFANAGTA |
Ga0209167_105349063 | 3300027867 | Surface Soil | NKRVQKVFEITKMERVFLMFPTLSDAIEAFTNAGSA |
Ga0209169_103856791 | 3300027879 | Soil | VNQRVQKVFEITKVEHVLLVFPTLADALEALTNAGSA |
Ga0209275_102472903 | 3300027884 | Soil | RRFAITGVNARVRRVFEITRVDNVLLTFPTLSDALEAFTNAGSA |
Ga0209380_101182334 | 3300027889 | Soil | VNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0209698_103057241 | 3300027911 | Watersheds | NKRVLKVFEITKVEHILLMFPTLSDAIEAFTNAGTA |
Ga0265357_10127093 | 3300028023 | Rhizosphere | KRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGSA |
Ga0265318_103630652 | 3300028577 | Rhizosphere | GVNKRVLRVFEITKVEQIFLMFPTLSDALEAFTNAGTA |
Ga0265338_105660701 | 3300028800 | Rhizosphere | KAGRRMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0302229_103286432 | 3300028879 | Palsa | KAGRRMALTGVNQRVLKVFQITKTEPLFLMFPTVSDALEAFTNAGTA |
Ga0302182_101617483 | 3300030054 | Palsa | ACTSCNKAGRRIALTGVNKRVLKVFEITKVESVFLMFPTLADAIEAFTNAGTA |
Ga0311370_119400902 | 3300030503 | Palsa | SCQKAGRRVALIGVNPRVLKVFEITKMEPIFLMFPTISDALEAFTNAGTA |
Ga0170834_1128922951 | 3300031057 | Forest Soil | CTSCAKAGRRMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0265339_103643201 | 3300031249 | Rhizosphere | VSACTSCTKSGRRMALTGVNKRVRKVFEITRVEQIFLMFPTLSDALEAFTNAGTA |
Ga0302326_102156544 | 3300031525 | Palsa | TGVNQRVLKVFQITKTEPLFLMFPTVSDALEAFTNAGTA |
Ga0265342_102587933 | 3300031712 | Rhizosphere | SACTSCAKSGRRMALTGVNRRVRKVFEITKVEQIFLMFPTLNDALEAFTNAGTA |
Ga0307474_115165852 | 3300031718 | Hardwood Forest Soil | KAGRRMALTGVNKRVLKVFEITRVEQIFLMFPTLSDALEAFTNAGSA |
Ga0306917_112404751 | 3300031719 | Soil | VSACTSCAKAGRRIALTGVNKRVLKVFEITKVENILLMFPTLADAIEAFTNAGTA |
Ga0318502_109766581 | 3300031747 | Soil | TGVNRRVLKVFEITKVENILLMFPTLSDAIEAFTNAGTA |
Ga0307478_1000236324 | 3300031823 | Hardwood Forest Soil | LTGVNKRVLKVFEITKVERIFLMFPTLSDALEAFTNAGTA |
Ga0310917_106844793 | 3300031833 | Soil | KAGRRVALTGINKRVLKVFEITKVEQIFLMFPTLSDAIEAFTNAGTA |
Ga0335085_118614412 | 3300032770 | Soil | AKSGRRMALTGVNKRVLKVFEITKMEQIFLMFPTLSDALEAFTNAGTA |
Ga0335085_125394902 | 3300032770 | Soil | RRMALTGVNKRVLKVFEITKVEQIFLMFPTLSDAIEAFTNAGTA |
Ga0335079_113903462 | 3300032783 | Soil | NARVRKVFEITKVENVLLTFPTLADALEALTNAGTA |
Ga0335078_118628311 | 3300032805 | Soil | KRVLKVFEITKVENVFLMFPTLSDALEAFTNAGTA |
Ga0335078_124120592 | 3300032805 | Soil | TSFAKSGRRLALTGVNKRVQKVFEITKVEQIFLMFPTLDDALEAFTNAGSA |
Ga0335081_123828412 | 3300032892 | Soil | LTGVNKRVLKVFEITKVERVFLMFPTLGDAIEAFTNAGTA |
Ga0335075_112556772 | 3300032896 | Soil | VSACTSCTKAGRRIALTGVNKRVLKVFEITKVEHVFLMFPTLSDAIEAFTNAGTA |
Ga0335071_100469336 | 3300032897 | Soil | RRLALTGVNKRVQKVFEITKVEQIFLMFPTLDDALEAFTNAGSA |
Ga0335071_108170171 | 3300032897 | Soil | TSCTKAGRRMALTGVNKRVLKVFEITKVEQIFLMFPTLSDAIEAFTNAGTA |
Ga0335071_118097582 | 3300032897 | Soil | GSLISACTSCTKAGRRVALTGVNQRVLKVFEITRVERALLLFPTLSDALEALTNAGTA |
Ga0335072_108641983 | 3300032898 | Soil | CAKSGRRMALTGVNKRVLKVFEITKMEQIFLMFPTLSDALEAFTNAGTA |
Ga0335076_101005441 | 3300032955 | Soil | SCAKSGRRVALTGVNKRVLKVFEITKVEQIFLMFPTLDDAIEAFTNAGTA |
Ga0335073_120709621 | 3300033134 | Soil | SACTSCAKSGRRMALTGVNKRVLKVFEITKMEQIFLMFPTLSDALEAFTNAGTA |
Ga0335077_117310081 | 3300033158 | Soil | VKSGRRMALTGVNKRVLKVFEITKVEQIFLMFPTLSDAIEAFTNAGTA |
Ga0326726_117682091 | 3300033433 | Peat Soil | SLVTACTSCAKAGRRIALTGVNKRVLKVFEITKVEQILLMFPTLGDAIEAFTNAGTA |
Ga0334790_210143_79_207 | 3300033887 | Soil | MALTGVNKRVRKVFEITKVEQIFLMFPTLSDALEAFTNAGTA |
⦗Top⦘ |