NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084398

Metagenome / Metatranscriptome Family F084398

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084398
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 90 residues
Representative Sequence MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMW
Number of Associated Samples 108
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 66.67 %
% of genes near scaffold ends (potentially truncated) 91.07 %
% of genes from short scaffolds (< 2000 bps) 82.14 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (54.464 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(26.786 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.071 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 63.22%    β-sheet: 16.09%    Coil/Unstructured: 20.69%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00203Ribosomal_S19 65.18
PF03947Ribosomal_L2_C 21.43
PF00276Ribosomal_L23 4.46
PF00297Ribosomal_L3 2.68
PF00573Ribosomal_L4 1.79
PF00177Ribosomal_S7 0.89
PF00252Ribosomal_L16 0.89
PF00012HSP70 0.89
PF07650KH_2 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 65.18
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 21.43
COG0089Ribosomal protein L23Translation, ribosomal structure and biogenesis [J] 4.46
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 2.68
COG0088Ribosomal protein L4Translation, ribosomal structure and biogenesis [J] 1.79
COG0049Ribosomal protein S7Translation, ribosomal structure and biogenesis [J] 0.89
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 0.89
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.11 %
UnclassifiedrootN/A0.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000127|SA_S1_NOR05_45mDRAFT_c10007264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales3495Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10100138All Organisms → cellular organisms → Eukaryota → Sar909Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10039516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2029Open in IMG/M
3300001824|ACM36_100701All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300003683|Ga0008459J53047_1006027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3148Open in IMG/M
3300005528|Ga0068872_10256259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria981Open in IMG/M
3300005827|Ga0074478_1257982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1764Open in IMG/M
3300005828|Ga0074475_10957810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1184Open in IMG/M
3300005942|Ga0070742_10017851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1872Open in IMG/M
3300006039|Ga0073915_10085167All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta584Open in IMG/M
3300006229|Ga0082389_145836All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta630Open in IMG/M
3300006366|Ga0075499_1230615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1363Open in IMG/M
3300006393|Ga0075517_1457641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3180Open in IMG/M
3300006394|Ga0075492_1044889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria4459Open in IMG/M
3300006396|Ga0075493_1583764All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta621Open in IMG/M
3300006400|Ga0075503_1051144All Organisms → cellular organisms → Eukaryota → Sar532Open in IMG/M
3300006569|Ga0075500_124724All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300006571|Ga0075505_1058718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2443Open in IMG/M
3300006641|Ga0075471_10121283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1395Open in IMG/M
3300006917|Ga0075472_10533883All Organisms → cellular organisms → Eukaryota → Sar585Open in IMG/M
3300007202|Ga0103274_1070314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2997Open in IMG/M
3300007236|Ga0075463_10231052All Organisms → cellular organisms → Eukaryota → Sar595Open in IMG/M
3300007241|Ga0075170_1416415All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta583Open in IMG/M
3300007551|Ga0102881_1166639All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta609Open in IMG/M
3300007554|Ga0102820_1171605All Organisms → cellular organisms → Eukaryota → Sar524Open in IMG/M
3300007561|Ga0102914_1092283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria947Open in IMG/M
3300007561|Ga0102914_1108936All Organisms → cellular organisms → Eukaryota → Sar863Open in IMG/M
3300007603|Ga0102921_1328478All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta544Open in IMG/M
3300007653|Ga0102868_1026963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1228Open in IMG/M
3300007715|Ga0102827_1088321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales698Open in IMG/M
3300007716|Ga0102867_1208281All Organisms → cellular organisms → Eukaryota → Sar539Open in IMG/M
3300007861|Ga0105736_1098490All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta632Open in IMG/M
3300007981|Ga0102904_1011335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1946Open in IMG/M
3300008118|Ga0114352_1130744All Organisms → cellular organisms → Eukaryota → Sar523Open in IMG/M
3300008930|Ga0103733_1000550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3167Open in IMG/M
3300008999|Ga0102816_1042834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1338Open in IMG/M
3300009001|Ga0102963_1192407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales815Open in IMG/M
3300009050|Ga0102909_1067684All Organisms → cellular organisms → Eukaryota → Sar880Open in IMG/M
3300009079|Ga0102814_10194780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1105Open in IMG/M
3300009080|Ga0102815_10091745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1660Open in IMG/M
3300009080|Ga0102815_10277856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria924Open in IMG/M
3300009086|Ga0102812_10670851All Organisms → cellular organisms → Eukaryota → Sar570Open in IMG/M
3300009124|Ga0118687_10204302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales721Open in IMG/M
3300009165|Ga0105102_10836744All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300009402|Ga0103742_1010798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1052Open in IMG/M
3300009433|Ga0115545_1162164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales776Open in IMG/M
3300009441|Ga0115007_11225907All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta523Open in IMG/M
3300009474|Ga0127390_1008183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3178Open in IMG/M
3300009543|Ga0115099_10075894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales1253Open in IMG/M
3300009544|Ga0115006_10067693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3134Open in IMG/M
3300009592|Ga0115101_1568912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3173Open in IMG/M
3300012370|Ga0123369_1011869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1161Open in IMG/M
3300012412|Ga0138266_1505634All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300012782|Ga0138268_1026432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria991Open in IMG/M
3300012928|Ga0163110_11421193All Organisms → cellular organisms → Eukaryota → Sar562Open in IMG/M
3300012966|Ga0129341_1352019All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta562Open in IMG/M
3300013115|Ga0171651_1156338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales710Open in IMG/M
3300017764|Ga0181385_1000127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria27284Open in IMG/M
3300018424|Ga0181591_10552523All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300018927|Ga0193083_10041412All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta660Open in IMG/M
3300019001|Ga0193034_10068233All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta766Open in IMG/M
3300019103|Ga0192946_1067464All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta514Open in IMG/M
3300019133|Ga0193089_1153893All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta504Open in IMG/M
3300019697|Ga0194007_1019493All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta664Open in IMG/M
3300019699|Ga0193985_1022990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria673Open in IMG/M
3300019701|Ga0194015_1010322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales922Open in IMG/M
3300019720|Ga0193991_1021913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria727Open in IMG/M
3300019732|Ga0194014_1061962All Organisms → cellular organisms → Eukaryota → Sar539Open in IMG/M
3300019745|Ga0194002_1027419All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300019757|Ga0193964_1110497All Organisms → cellular organisms → Eukaryota → Sar576Open in IMG/M
3300019766|Ga0193959_1212301All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300020109|Ga0194112_10080102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3032Open in IMG/M
3300020141|Ga0211732_1457947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya975Open in IMG/M
3300021085|Ga0206677_10355174All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta568Open in IMG/M
3300021108|Ga0214162_1002980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3478Open in IMG/M
3300021293|Ga0210358_110912All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta552Open in IMG/M
3300021299|Ga0210302_1115414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1005Open in IMG/M
3300021305|Ga0210296_1125783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1868Open in IMG/M
3300021335|Ga0213867_1286068All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta523Open in IMG/M
3300021465|Ga0193947_1074063All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta538Open in IMG/M
3300021964|Ga0222719_10504444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria725Open in IMG/M
3300022214|Ga0224505_10394440All Organisms → cellular organisms → Eukaryota → Sar524Open in IMG/M
3300022223|Ga0224501_10207437All Organisms → cellular organisms → Eukaryota → Sar1068Open in IMG/M
(restricted) 3300022920|Ga0233426_10335718All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta577Open in IMG/M
3300024343|Ga0244777_10672683All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta621Open in IMG/M
3300024346|Ga0244775_10512008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria979Open in IMG/M
3300024346|Ga0244775_11507954All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta514Open in IMG/M
3300024532|Ga0256352_1044376All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300024544|Ga0255294_1038463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria856Open in IMG/M
3300025690|Ga0209505_1092631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209877Open in IMG/M
3300025879|Ga0209555_10343671All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta559Open in IMG/M
3300025887|Ga0208544_10382398All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300026563|Ga0256355_1001560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3218Open in IMG/M
3300027185|Ga0208672_1013854All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300027193|Ga0208800_1061133All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta513Open in IMG/M
3300027198|Ga0208163_1004717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2552Open in IMG/M
3300027210|Ga0208802_1040438All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta637Open in IMG/M
3300027217|Ga0208928_1000351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9419Open in IMG/M
3300027235|Ga0208804_1017689All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta695Open in IMG/M
3300027237|Ga0208930_1008363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1521Open in IMG/M
3300027278|Ga0208439_1091800All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta548Open in IMG/M
3300027571|Ga0208897_1062534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya976Open in IMG/M
3300027751|Ga0208304_10125888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria953Open in IMG/M
3300027786|Ga0209812_10164066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1037Open in IMG/M
3300027806|Ga0209985_10503808All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta506Open in IMG/M
(restricted) 3300027865|Ga0255052_10338845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria735Open in IMG/M
3300028089|Ga0255299_1056539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria733Open in IMG/M
3300028267|Ga0256358_1005976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2239Open in IMG/M
3300031523|Ga0307492_10011250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3264Open in IMG/M
3300031589|Ga0307996_1160986All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300032093|Ga0315902_11140927All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta567Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine25.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.71%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment6.25%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.25%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.36%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.57%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.68%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine2.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.79%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.79%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat1.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.79%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.79%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.79%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.79%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.79%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.89%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.89%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.89%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.89%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.89%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.89%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.89%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.89%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.89%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.89%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.89%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.89%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.89%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.89%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300001824Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM36, ROCA_DNA073_0.2um_10gEnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006039Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_30-Apr-14EnvironmentalOpen in IMG/M
3300006229Marine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143EnvironmentalOpen in IMG/M
3300006366Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006569Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007202Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site C) 9 sequencing projectsEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007241Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007653Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300008118Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTREnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009474Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019697Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_3-4_MGEnvironmentalOpen in IMG/M
3300019699Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MGEnvironmentalOpen in IMG/M
3300019701Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_1-2_MGEnvironmentalOpen in IMG/M
3300019720Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_2-3_MGEnvironmentalOpen in IMG/M
3300019732Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MGEnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300019757Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_7_MGEnvironmentalOpen in IMG/M
3300019766Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_2_MGEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021108Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300021293Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.589 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021465Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MGEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022223Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024532Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024544Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026563Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027185Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027210Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027217Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027237Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027278Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300028089Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028267Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR05_45mDRAFT_1000726443300000127MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTQKTNL*VQNPKI*
SA_S1_NOR08_45mDRAFT_1010013833300000128MarineMARLELTLNFPKSFQIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYEIYINKVSTQKTNL*
SA_S2_NOR15_50mDRAFT_1003951633300000130MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTE*
ACM36_10070113300001824Marine PlanktonMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYE
Ga0008459J53047_100602763300003683SeawaterMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIXYLLKSNPIERDFLLQALYSIVISLQNNLSINF
Ga0068872_1025625913300005528Freshwater LakeMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNL
Ga0074478_125798243300005827Sediment (Intertidal)MARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMW
Ga0074475_1095781013300005828Sediment (Intertidal)MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFM
Ga0070742_1001785113300005942EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVIS
Ga0073915_1008516713300006039SandMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFD
Ga0082389_14583613300006229MarineMARLELTLNFPKSFQVKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVSSHN
Ga0075499_123061513300006366AqueousMARLELTLNFPKRFHIKTFNVKSEPMLSSLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIAISLQNNLAINFFDMW
Ga0075517_145764163300006393AqueousMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLLQALYSIVISLQNNLCINFFDMWVYE
Ga0075492_104488973300006394AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFF
Ga0075493_158376413300006396AqueousMACTSRGELTLKFPKNFHIKTFNVKSEKILSPLAKSILQSVQFKHFYYVRDDLYYLLKSEPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEVYINKVSSHNKFMNEKS
Ga0075503_105114423300006400AqueousMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSI
Ga0075500_12472413300006569AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDIW
Ga0075505_105871813300006571AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSSHNKF
Ga0075471_1012128333300006641AqueousMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYFLKSNPTEKDFLLEALYSIVISLQNNLSINFFD
Ga0075472_1053388313300006917AqueousMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNN
Ga0103274_107031463300007202Freshwater LakeMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEI
Ga0075463_1023105223300007236AqueousMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLLQALYSIVISLQNNLCIN
Ga0075170_141641513300007241Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKANPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKVSNHNKFIDKK
Ga0102881_116663923300007551EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQ
Ga0102820_117160513300007554EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVIS
Ga0102914_109228313300007561EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTH
Ga0102914_110893633300007561EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIY
Ga0102921_132847813300007603EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVST
Ga0102868_102696313300007653EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNL
Ga0102827_108832113300007715EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNL
Ga0102867_120828113300007716EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSILISLQNNLSIN
Ga0105736_109849013300007861Estuary WaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVST
Ga0102904_101133513300007981EstuarineMGKRKKRKAELTLRFPENFQLATFNIKYENKLSPLAKFILQGMQFKHFYYARDDIFYLLNSNPIEQQFLLQALYSISISLQNNLS
Ga0114352_113074423300008118Freshwater, PlanktonMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSI
Ga0103733_100055013300008930Ice Edge, Mcmurdo Sound, AntarcticaMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLCINFFDMWVYEVYVNKIPNFNKFM
Ga0102816_104283413300008999EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLMLQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDM
Ga0102963_119240713300009001Pond WaterMARLELTLNFPKSFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRNDISYLLKSNPVERDFLLQALYSTVISLQNNLSISFFDIWIYEIYINKVSTHNKF
Ga0102909_106768433300009050EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFICGFMKFI*
Ga0102814_1019478013300009079EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLS
Ga0102815_1009174513300009080EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSIN
Ga0102815_1027785633300009080EstuarineMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMWIYEIYIN
Ga0102812_1067085113300009086EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVIS
Ga0118687_1020430213300009124SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNL
Ga0105102_1083674423300009165Freshwater SedimentMARLELTLNFPKHFYIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIYYRLRSHPMERDFLLQALFSIA
Ga0103742_101079833300009402Ice Edge, Mcmurdo Sound, AntarcticaMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLCINFFDMWVYE
Ga0115545_116216433300009433Pelagic MarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVSDDISHLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYI
Ga0115007_1122590723300009441MarineMSKQIKKYNVKKPRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQCKHFYYARDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMW
Ga0127390_100818363300009474Meromictic PondMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLLQALYSIVISLQNNFSINFF
Ga0115099_1007589413300009543MarineMARLELTLNFPKRFHIKTFNVKCEKILSPSAKIVLQSAQFKHFYYVRDDIYYLLKSYPTERDFLLQALYSIVISLQNNLAVNFFDMW
Ga0115006_1006769313300009544MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFM
Ga0115101_156891213300009592MarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMW
Ga0123369_101186933300012370MarineMTCKKRKELTLKFPKCFHIKTFNVKSENSLSPLAKSILQSLQFKHFYYVFDDIYYLLNSQSIERDFLLQTLSSIVISIQNNLSINFF
Ga0138266_150563423300012412Polar MarineMLKKQKKPRVELTFDFPKNFHVETFNIKSEKKLSPLAKVILQGIQFKHFYYARDDIFYLLNPAPIERDFLLQALNSIV
Ga0138268_102643233300012782Polar MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALSSIVISLQNNLSINFFDMWIYE
Ga0163110_1142119313300012928Surface SeawaterMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNN
Ga0129341_135201913300012966AqueousMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLLQALYSIVISLQNNFSINFFDM
Ga0171651_115633813300013115MarineMARLELTLNFPKNFQTKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNF
Ga0181385_1000127153300017764SeawaterMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDM
Ga0181591_1055252333300018424Salt MarshMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEVYINKVS
Ga0193083_1004141213300018927MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKVILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKV
Ga0193034_1006823323300019001MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFLICGFMRFISIKFQAIIDL
Ga0192946_106746413300019103MarineMLKKQKKPRVELTFDFPKNFHVETFNIKSEKKLSPLAKVILQGIQFKHFYYARDDIFYLLNPAPIERDFLLQALNSIVISLQNNLSINFFDMWIYEIYINKVSTKNRFI
Ga0193089_115389323300019133MarineMARLELTLNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFYYVRDDISYLLRSNPTERDFLLQALYSIVISLQNNLCINFFDMWIYEVYINKVPNFNKFMN
Ga0194007_101949313300019697SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSNNKF
Ga0193985_102299033300019699SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMW
Ga0194015_101032233300019701SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSIH
Ga0193991_102191333300019720SedimentMARLELTLNFPKNFEIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINFFDMW
Ga0194014_106196223300019732SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSI
Ga0194002_102741913300019745SedimentMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAISLQNNLSINFFDMWVYEIY
Ga0193964_111049713300019757Freshwater Microbial MatMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLS
Ga0193959_121230123300019766Freshwater Microbial MatMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNLSIN
Ga0194112_1008010213300020109Freshwater LakeMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKV
Ga0211732_145794733300020141FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVS
Ga0206677_1035517413300021085SeawaterMARLELTLNFPKSFQVKTFNVKSQKKLSPLAKLILQSVQFKHFYYVRDDLSYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWI
Ga0214162_100298013300021108FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFD
Ga0210358_11091223300021293EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDM
Ga0210302_111541433300021299EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSI
Ga0210296_112578333300021305EstuarineMGKRKKRKTELTLRFPRNFQCATFNIKSENKLSPLAKFVLQGMQFKHFYYARDDIFYLLNSNPIEQDFLLQALYSISISLQNNYL
Ga0213867_128606813300021335SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFD
Ga0193947_107406323300021465SedimentMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMW
Ga0222719_1050444413300021964Estuarine WaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWV
Ga0224505_1039444013300022214SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSTVISLQNNLSINF
Ga0224501_1020743713300022223SedimentMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAICLQNNLSVNFFDMWIYEIYITKISTPN
(restricted) Ga0233426_1033571823300022920SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYIN
Ga0244777_1067268313300024343EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWVYEIYI
Ga0244775_1051200833300024346EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVS
Ga0244775_1150795413300024346EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVLSLQNNLSINFFDMWIYEIYINKVSIHNKFM
Ga0256352_104437613300024532FreshwaterMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFSIVISLQNNLSINFFDM
Ga0255294_103846313300024544FreshwaterMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPREREFLLQTLFSIAISLQNNLSIV
Ga0209505_109263123300025690Pelagic MarineMAGLELTLNFPESFHIKTFNLQPKKKLSPLANSILSSLKFKHFYYIRDDIAYLLKSNPVERDFLLQAFYSIILSLQNNLSVNFFVGTGIIVFSSLIIIRQETKKN
Ga0209555_1034367123300025879MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIERYFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSI
Ga0208544_1038239823300025887AqueousMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTY
Ga0256355_100156013300026563FreshwaterMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPTEREFLLQTLFSIAISLQNNLSIDFF
Ga0256355_105405033300026563FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALHSIVISLQNNL
Ga0208672_101385413300027185EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFF
Ga0208800_106113313300027193EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSVNFFDM
Ga0208163_100471713300027198EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSSHNKFMN
Ga0208802_104043813300027210EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYIN
Ga0208928_1000351153300027217EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEI
Ga0208804_101768913300027235EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSTVISLQNNLSINIFDIWIYEIYINKVSTH
Ga0208930_100836333300027237EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHN
Ga0208439_109180023300027278EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYISKVSTHN
Ga0208897_106253413300027571EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQN
Ga0208304_1012588833300027751EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFLLQALYSIVISLQNNLSINF
Ga0209812_1016406633300027786Wastewater EffluentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFLLQALYSIVISLQNNLSINFFDMWVYEIYINKV
Ga0209985_1050380813300027806Freshwater LakeMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDM
(restricted) Ga0255052_1033884513300027865SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIYEVYINKVPSHNKFMN
Ga0255299_105653913300028089FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSIDFFDM
Ga0256358_100597653300028267FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLSINFFDMWIY
Ga0307492_1001125063300031523Sea-Ice BrineMGRIELTLDFPEEFEIKTFNVKCEKNLSPLSKSILQSAKCKHYYYVLDDISDRLKSNPIESAFLSQALNSTVISLQNNLSINFLDIWVYEIY
Ga0307996_116098623300031589MarineMSNRIKNYNVKKTRKKRRLELTLNFPKSFQIKTFNVRSEKKLSSLAKLILQSVQFKHFYYARDDIFYLLKSNIAERDFILQALYSIVISLQNNLSINFF
Ga0315902_1114092723300032093FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.