Metagenome Family F084296

Basic Information
Family ID	F084296
Family Type	Metagenome
Number of Sequences	112
Average Sequence Length	43 residues
Representative Sequence	YQRGVVQTDYGLSTAMGVVLLVLAFAVTYFSLRYSRGALVE
Number of Associated Samples	101
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	94.64 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Most Common Taxonomy
Group	Bacteria (97.321 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.286 % of family members)
Environment Ontology (ENVO)	Unclassified (28.571 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (40.179 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.07% β-sheet: 0.00% Coil/Unstructured: 44.93%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF00528	BPD_transp_1	44.64
PF00005	ABC_tran	8.93
PF08402	TOBE_2	3.57
PF00296	Bac_luciferase	0.89
PF00171	Aldedh	0.89
PF02878	PGM_PMM_I	0.89
PF03949	Malic_M	0.89
PF13660	DUF4147	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.89
COG0033	Phosphoglucomutase/phosphomannomutase	Carbohydrate transport and metabolism [G]	0.89
COG0281	Malic enzyme	Energy production and conversion [C]	0.89
COG0686	Alanine dehydrogenase (includes sporulation protein SpoVN)	Amino acid transport and metabolism [E]	0.89
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.89
COG1109	Phosphomannomutase	Carbohydrate transport and metabolism [G]	0.89
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.89
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.32 %
Unclassified	root	N/A	2.68 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.32 %
Unclassified	root	N/A	2.68 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.32 %
Unclassified	root	N/A	2.68 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	55.36 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	12.50 %
Unclassified	root	N/A	2.68 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	53.57 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3.57 %
Unclassified	root	N/A	2.68 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.79 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.89 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	53.57 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3.57 %
Unclassified	root	N/A	2.68 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.79 %
Oceanospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales	0.89 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	53.57 %
Unclassified	root	N/A	2.68 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	0.89 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.89 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.89 %
Halomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	53.57 %
Unclassified	root	N/A	2.68 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.89 %
Halotalea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halotalea	0.89 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	0.89 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	53.57 %
Unclassified	root	N/A	2.68 %
Yinghuangia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia	0.89 %
Halotalea alkalilenta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halotalea → Halotalea alkalilenta	0.89 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.89 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	53.57 %
Unclassified	root	N/A	2.68 %
unclassified Yinghuangia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia	0.89 %
Halotalea alkalilenta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halotalea → Halotalea alkalilenta	0.89 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.89 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.89 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	53.57 %
Unclassified	root	N/A	2.68 %
Yinghuangia sp. KLBMP8922	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia → Yinghuangia sp. KLBMP8922	0.89 %
Halotalea alkalilenta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halotalea → Halotalea alkalilenta	0.89 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.89 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101622755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	661	Open in IMG/M
3300000955\|JGI1027J12803_104628560	Not Available	532	Open in IMG/M
3300000955\|JGI1027J12803_107040160	Not Available	507	Open in IMG/M
3300003319\|soilL2_10180050	All Organisms → cellular organisms → Bacteria	1260	Open in IMG/M
3300003321\|soilH1_10216084	All Organisms → cellular organisms → Bacteria → Proteobacteria	1115	Open in IMG/M
3300003324\|soilH2_10142100	All Organisms → cellular organisms → Bacteria → Proteobacteria	3288	Open in IMG/M
3300003324\|soilH2_10326680	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300004114\|Ga0062593_101679093	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300004479\|Ga0062595_102637437	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300004480\|Ga0062592_100935352	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	785	Open in IMG/M
3300005330\|Ga0070690_100549870	All Organisms → cellular organisms → Bacteria	870	Open in IMG/M
3300005336\|Ga0070680_100837900	All Organisms → cellular organisms → Bacteria	793	Open in IMG/M
3300005338\|Ga0068868_100446976	All Organisms → cellular organisms → Bacteria	1124	Open in IMG/M
3300005339\|Ga0070660_101256990	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300005466\|Ga0070685_11621492	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300005518\|Ga0070699_101683455	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300005546\|Ga0070696_101475564	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	581	Open in IMG/M
3300005556\|Ga0066707_10457128	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300005578\|Ga0068854_100137496	All Organisms → cellular organisms → Bacteria → Proteobacteria	1872	Open in IMG/M
3300005615\|Ga0070702_101581113	All Organisms → cellular organisms → Bacteria	542	Open in IMG/M
3300006038\|Ga0075365_11062488	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300006358\|Ga0068871_100524189	All Organisms → cellular organisms → Bacteria	1070	Open in IMG/M
3300006794\|Ga0066658_10404311	All Organisms → cellular organisms → Bacteria	741	Open in IMG/M
3300006797\|Ga0066659_10804414	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	778	Open in IMG/M
3300006845\|Ga0075421_101722233	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	677	Open in IMG/M
3300006854\|Ga0075425_101573188	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	741	Open in IMG/M
3300006903\|Ga0075426_10321408	All Organisms → cellular organisms → Bacteria	1134	Open in IMG/M
3300006904\|Ga0075424_102849866	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300009094\|Ga0111539_10858993	All Organisms → cellular organisms → Bacteria	1056	Open in IMG/M
3300009098\|Ga0105245_11492494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	727	Open in IMG/M
3300009098\|Ga0105245_12329190	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	589	Open in IMG/M
3300009100\|Ga0075418_11104308	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	859	Open in IMG/M
3300009101\|Ga0105247_10254347	All Organisms → cellular organisms → Bacteria → Proteobacteria	1202	Open in IMG/M
3300009137\|Ga0066709_101104519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1166	Open in IMG/M
3300009162\|Ga0075423_11673524	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	685	Open in IMG/M
3300009174\|Ga0105241_10963245	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	796	Open in IMG/M
3300009540\|Ga0073899_11049692	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	572	Open in IMG/M
3300009553\|Ga0105249_10193577	All Organisms → cellular organisms → Bacteria	1986	Open in IMG/M
3300009553\|Ga0105249_11784572	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	688	Open in IMG/M
3300009553\|Ga0105249_12364404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	604	Open in IMG/M
3300009691\|Ga0114944_1223866	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	757	Open in IMG/M
3300009702\|Ga0114931_10054044	All Organisms → cellular organisms → Bacteria	3883	Open in IMG/M
3300009870\|Ga0131092_11404373	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	536	Open in IMG/M
3300010044\|Ga0126310_11565745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	543	Open in IMG/M
3300010323\|Ga0134086_10096212	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1043	Open in IMG/M
3300010371\|Ga0134125_11901071	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	647	Open in IMG/M
3300010373\|Ga0134128_11089919	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	882	Open in IMG/M
3300010397\|Ga0134124_12718568	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	538	Open in IMG/M
3300010399\|Ga0134127_10366032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1414	Open in IMG/M
3300012210\|Ga0137378_10507737	All Organisms → cellular organisms → Bacteria → Proteobacteria	1113	Open in IMG/M
3300012285\|Ga0137370_10888131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	551	Open in IMG/M
3300012353\|Ga0137367_10249351	All Organisms → cellular organisms → Bacteria → Proteobacteria	1277	Open in IMG/M
3300012354\|Ga0137366_10227949	All Organisms → cellular organisms → Bacteria → Proteobacteria	1386	Open in IMG/M
3300012519\|Ga0157352_1023153	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	770	Open in IMG/M
3300012901\|Ga0157288_10021994	All Organisms → cellular organisms → Bacteria	1231	Open in IMG/M
3300012903\|Ga0157289_10067892	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300012906\|Ga0157295_10262465	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	585	Open in IMG/M
3300012912\|Ga0157306_10246077	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	628	Open in IMG/M
3300012943\|Ga0164241_10997947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Yinghuangia → unclassified Yinghuangia → Yinghuangia sp. KLBMP8922	614	Open in IMG/M
3300012951\|Ga0164300_10457640	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	718	Open in IMG/M
3300012951\|Ga0164300_10697667	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	614	Open in IMG/M
3300012957\|Ga0164303_10042212	All Organisms → cellular organisms → Bacteria	1965	Open in IMG/M
3300012957\|Ga0164303_10556101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	746	Open in IMG/M
3300012958\|Ga0164299_10364974	All Organisms → cellular organisms → Bacteria	914	Open in IMG/M
3300012958\|Ga0164299_11351016	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	548	Open in IMG/M
3300012961\|Ga0164302_10550209	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	826	Open in IMG/M
3300012989\|Ga0164305_11093743	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	684	Open in IMG/M
3300013297\|Ga0157378_13224216	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	507	Open in IMG/M
3300013308\|Ga0157375_11669932	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	754	Open in IMG/M
3300014325\|Ga0163163_10944840	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300014827\|Ga0120171_1101467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	726	Open in IMG/M
3300014968\|Ga0157379_10977441	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	806	Open in IMG/M
3300015200\|Ga0173480_10912553	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	571	Open in IMG/M
3300018028\|Ga0184608_10246166	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	786	Open in IMG/M
3300018028\|Ga0184608_10306990	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	697	Open in IMG/M
3300018029\|Ga0187787_10028195	All Organisms → cellular organisms → Bacteria	1551	Open in IMG/M
3300018053\|Ga0184626_10014188	All Organisms → cellular organisms → Bacteria	3161	Open in IMG/M
3300018054\|Ga0184621_10331734	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	535	Open in IMG/M
3300018071\|Ga0184618_10382632	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	597	Open in IMG/M
3300018074\|Ga0184640_10263094	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	783	Open in IMG/M
3300018076\|Ga0184609_10458299	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	585	Open in IMG/M
3300018079\|Ga0184627_10144794	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300021081\|Ga0210379_10463567	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	562	Open in IMG/M
3300021339\|Ga0193706_1164040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	605	Open in IMG/M
3300022898\|Ga0247745_1006958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1480	Open in IMG/M
3300025313\|Ga0209431_10703899	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	746	Open in IMG/M
3300025885\|Ga0207653_10339177	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	586	Open in IMG/M
3300025910\|Ga0207684_10031607	All Organisms → cellular organisms → Bacteria → Proteobacteria	4502	Open in IMG/M
3300025912\|Ga0207707_10057123	All Organisms → cellular organisms → Bacteria → Proteobacteria	3397	Open in IMG/M
3300025925\|Ga0207650_10207784	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1571	Open in IMG/M
3300025933\|Ga0207706_10859342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	768	Open in IMG/M
3300025935\|Ga0207709_10230666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Halomonadaceae → Halotalea → Halotalea alkalilenta	1341	Open in IMG/M
3300025961\|Ga0207712_11923193	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	530	Open in IMG/M
3300026121\|Ga0207683_10055347	All Organisms → cellular organisms → Bacteria	3478	Open in IMG/M
3300026142\|Ga0207698_10875673	All Organisms → cellular organisms → Bacteria	904	Open in IMG/M
3300027909\|Ga0209382_11278745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	745	Open in IMG/M
3300028536\|Ga0137415_11053195	Not Available	626	Open in IMG/M
3300028587\|Ga0247828_10382834	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	804	Open in IMG/M
3300028885\|Ga0307304_10366049	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	646	Open in IMG/M
3300031547\|Ga0310887_10869865	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	569	Open in IMG/M
3300031820\|Ga0307473_11490081	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	513	Open in IMG/M
3300031858\|Ga0310892_10830092	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	643	Open in IMG/M
3300031858\|Ga0310892_11131021	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	556	Open in IMG/M
3300031873\|Ga0315297_10225484	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1549	Open in IMG/M
3300031918\|Ga0311367_10613628	All Organisms → cellular organisms → Bacteria	1110	Open in IMG/M
3300032000\|Ga0310903_10116407	All Organisms → cellular organisms → Bacteria	1161	Open in IMG/M
3300032000\|Ga0310903_10586371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	592	Open in IMG/M
3300032003\|Ga0310897_10609279	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	540	Open in IMG/M
3300032075\|Ga0310890_11766203	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	514	Open in IMG/M
3300032174\|Ga0307470_10385741	All Organisms → cellular organisms → Bacteria	985	Open in IMG/M
3300032205\|Ga0307472_102364892	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	539	Open in IMG/M
3300033500\|Ga0326730_1064132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	695	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.43%
Host-Associated	Host-Associated	26.79%
Engineered	Engineered	1.79%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	60.71%
Plants	Host-Associated → Plants	26.79%
Aquatic	Environmental → Aquatic	10.71%
Wastewater	Engineered → Wastewater	1.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.54%
Sediment	Environmental → Aquatic → Sediment	7.14%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.57%
Roots	Host-Associated → Plants → Roots	2.68%
Freshwater	Environmental → Aquatic → Freshwater	1.79%
Peat	Environmental → Terrestrial → Peat	1.79%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.79%
Marine	Environmental → Aquatic → Marine	0.89%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	49.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.86%
Loam	Environmental → Terrestrial → Soil → Loam	8.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.14%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.68%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.68%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.79%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.79%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%
Lake	Environmental → Aquatic → Freshwater → Lake	0.89%
Volcanic	Environmental → Aquatic → Marine → Volcanic	0.89%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.89%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.89%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.89%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.86%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.04%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.14%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	7.14%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	7.14%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.25%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.68%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.68%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.79%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.79%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.89%
Unclassified	Environmental → Aquatic → Marine → Volcanic → Unclassified	0.89%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.89%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.89%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.89%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.89%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	14.29%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	7.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	7.14%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.36%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.46%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	4.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.57%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	3.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.68%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.79%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.79%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.79%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.89%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.89%
Deep Subsurface	Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface	0.89%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.89%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.89%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.89%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.89%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.89%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.89%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.89%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.89%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.89%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.89%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300003321	Sugarcane bulk soil Sample H1	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009540	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph	Engineered	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009691	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2	Environmental	Open in IMG/M
3300009702	Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG	Environmental	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012519	Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014827	Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental	Open in IMG/M
3300022898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5	Environmental	Open in IMG/M
3300025313	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033500	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F084296

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1016227552	3300000364	Soil	YQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALIE*
JGI1027J12803_1046285601	3300000955	Soil	AWTLYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALIE*
JGI1027J12803_1070401601	3300000955	Soil	GVISTDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE*
soilL2_101800503	3300003319	Sugarcane Root And Bulk Soil	TLYQRGVVQTDYGLSTAMGVVLLILAFTVTYFSLRYSRGALVE*
soilH1_102160843	3300003321	Sugarcane Root And Bulk Soil	YQRGVVQTDYGLASAMSVVLLVIAVVGGYFSLRYSRGALVD*
soilH2_101421001	3300003324	Sugarcane Root And Bulk Soil	RGVVQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVE*
soilH2_103266801	3300003324	Sugarcane Root And Bulk Soil	RGVVQTDYGLSSAMSVLLLVIAFVVSYVSLRYSRGALFQ*
Ga0062593_1016790931	3300004114	Soil	WTLYQRGVVQTDYGLSTTMGVILLILAFTVTYFSLRYSRGALLE*
Ga0062595_1026374371	3300004479	Soil	WTLYQRGVISTDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE*
Ga0062592_1009353522	3300004480	Soil	QRGVVQTDYGLSTTMGVILLILAFTVTYFSLRYSRGALLE*
Ga0070690_1005498702	3300005330	Switchgrass Rhizosphere	TLAWTLYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALVE*
Ga0070680_1008379001	3300005336	Corn Rhizosphere	YDRGVVQNDYGLASAMGMVLLAVAFVVTYFSLRYSRGALAE*
Ga0068868_1004469763	3300005338	Miscanthus Rhizosphere	RGVVQTDYGLSTAMGVVLLIVAFVVTYLSLRYSRGALVE*
Ga0070660_1012569902	3300005339	Corn Rhizosphere	VTIYDRGVVQNDYGLASAMGVLLLAIAFVVTYFSLRYSRGALAE*
Ga0070685_116214922	3300005466	Switchgrass Rhizosphere	TIYDRGVVQNDYGLGSAMGVVLLAIAFIVTYFSLRYSRGALAE*
Ga0070699_1016834551	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	EQRSLAWTVYQNAVVENDYGIASAMGIVLLALAFAVTYFSLRYSRGALVE*
Ga0070696_1014755642	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	QRGVVQTDYGLSSAMSVVLLIIAFIVSYFSLRYSRGALVE*
Ga0066707_104571282	3300005556	Soil	EQRALAWTVYQRGVVQTDYGLSTAMGTVLLIIAFAVTYLSLRYSRGALVE*
Ga0068854_1001374963	3300005578	Corn Rhizosphere	DRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE*
Ga0070702_1015811132	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	YQRGVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALVE*
Ga0075365_110624881	3300006038	Populus Endosphere	YQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE*
Ga0068871_1005241893	3300006358	Miscanthus Rhizosphere	QRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE*
Ga0066658_104043111	3300006794	Soil	RSLAWTVYQNAVVENAYGIASAMGIVLLALAFVVTYFSLRYSRGALVE*
Ga0066659_108044141	3300006797	Soil	TDYGLATTMGVVLLAFAFVVTYFSLRYSRGALIE*
Ga0075421_1017222332	3300006845	Populus Rhizosphere	YQRGVVQTDYGLSTTMGVVLLILAFTVTYFSLRYSRGALVE*
Ga0075425_1015731881	3300006854	Populus Rhizosphere	RGVVQSDYGLASTMGIVLLAIAFVVTYFSLRYTRGALAE*
Ga0075426_103214083	3300006903	Populus Rhizosphere	AWTVYQRGVVQTDYGLSTAMGVVLLLVAFVVTYLSLRYSRGALVE*
Ga0075424_1028498661	3300006904	Populus Rhizosphere	WTVYQRGVVQTDYGLSTAMGVVLLLVAFVVTYLSLRYSRGALVE*
Ga0111539_108589933	3300009094	Populus Rhizosphere	ALAWTLYQRGVVQTDYGLASAMSVVLLIIAVVVSYFSLRYSRGALVD*
Ga0105245_114924942	3300009098	Miscanthus Rhizosphere	LYQRGVVQTDYGLASAMSVVLLIITVVVSYFSLRYSRGALVD*
Ga0105245_123291902	3300009098	Miscanthus Rhizosphere	VQTDYGLSTAMGVVLLLVAFVVTYLSLRYSRGALVE*
Ga0075418_111043081	3300009100	Populus Rhizosphere	GVVQTDYGLSSAMSVVLLVIAFIVSYFSLRYSRGALVS*
Ga0105247_102543473	3300009101	Switchgrass Rhizosphere	EQKSLAWTLYQRGVVQTDYGLATTMGVVLLVLAFTVTYFSLRYSRGALIE*
Ga0066709_1011045193	3300009137	Grasslands Soil	ALAWTVYQRGVVQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVA*
Ga0075423_116735242	3300009162	Populus Rhizosphere	GVVQSDYGISSAMSVVLLVVAFAVSYFALRYSRGALVQ*
Ga0105241_109632452	3300009174	Corn Rhizosphere	LYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYLRGALVE*
Ga0073899_110496921	3300009540	Activated Sludge	NEQRTLAWTLYQRGVVQTDYGLSTAMGIMLLIMAFLVTYASLRFSKGALVE*
Ga0105249_101935771	3300009553	Switchgrass Rhizosphere	VVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE*
Ga0105249_117845721	3300009553	Switchgrass Rhizosphere	QKSLAWTLYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE*
Ga0105249_123644041	3300009553	Switchgrass Rhizosphere	TIYDRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE*
Ga0114944_12238661	3300009691	Thermal Springs	VVQTDYGLSTTMGVVLLVLAFTVTYFSLRYSRGALVE*
Ga0114931_100540441	3300009702	Deep Subsurface	QRAMAWTLYQRGVVQLDYGLGTTMGVVLMVLAFTVNYVSLRYSRGALVQ*
Ga0131092_114043732	3300009870	Activated Sludge	MALTLYNRGIVLFDYGTSATMGVVLMVIAFSVTYFSLRYSRGALVD*
Ga0126310_115657451	3300010044	Serpentine Soil	QKSLAWTLYQRGVVQTDYGLSTTMGVVLLILAFTVTYFSLRYSGGALVE*
Ga0134086_100962121	3300010323	Grasslands Soil	VVQTDYGLATTMGVVLLAFAFVVTYFSLRYSRGALIE*
Ga0134125_119010712	3300010371	Terrestrial Soil	YDRGVVQNDYGLASAMGVLLLAIAFVVTYFSLRYSRGALAE*
Ga0134128_110899191	3300010373	Terrestrial Soil	EQHSLAVTIYDRGVVQNDYGLASAMGVVLLAVAFVVTYFSLRYSRGALAE*
Ga0134124_127185682	3300010397	Terrestrial Soil	VQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVE*
Ga0134127_103660323	3300010399	Terrestrial Soil	LYQRGVVQTDYGLSSAMSVVLLVIAFIVSYFSLRYSRGALVE*
Ga0137378_105077371	3300012210	Vadose Zone Soil	TVYQNAVVENDSGIASAMGIVLLALAFVVTYFSLRYSRGALVE*
Ga0137370_108881311	3300012285	Vadose Zone Soil	DQRSLAWTVYQNAVVENDYGIASAMGIVLLALAFVVTYFSLRYSRGALVE*
Ga0137367_102493511	3300012353	Vadose Zone Soil	NDYGLSSTMGIVLLSIAFIVTYFSLRYSRGALIE*
Ga0137366_102279493	3300012354	Vadose Zone Soil	AVQNDYGLSSTMGIVLLSIAFAVTYFSLRYSRGALVE*
Ga0157352_10231531	3300012519	Unplanted Soil	QRGVVQTDYGLSTAMGVVLLIVAFVVTYLSLRYSRGALVE*
Ga0157288_100219943	3300012901	Soil	STDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE*
Ga0157289_100678921	3300012903	Soil	QRTLAWTLYQRGVISTDYGVSATMGIVLLLVAFVVTYFSLRFSRGALVE*
Ga0157295_102624652	3300012906	Soil	VQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE*
Ga0157306_102460771	3300012912	Soil	RSLAWTLYQRGVVQTDYGLSTTMGVILLILAFTVTYFSLRYSRGALLE*
Ga0164241_109979471	3300012943	Soil	VVQSDYGLSSAMSIVLMVLAVVVSYTSLRYSRNALV*
Ga0164300_104576401	3300012951	Soil	QRGVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALIE*
Ga0164300_106976672	3300012951	Soil	NEQRSLALTIYERGVVQNDYGLSSTMGIVLLLLAFLVTYFSLRYSRGALAE*
Ga0164303_100422123	3300012957	Soil	STVYQRGVVQTDYGLSTAMGDVLLLVAFVVTSLSLRYSRGALVE*
Ga0164303_105561012	3300012957	Soil	ALTLYQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE*
Ga0164299_103649741	3300012958	Soil	QRALAWTLFQRGVVQTDYGLASAMSVVLLVIAVVVSYFSLRYSRGALVD*
Ga0164299_113510161	3300012958	Soil	GVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALVE*
Ga0164302_105502091	3300012961	Soil	LYQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE*
Ga0164305_110937432	3300012989	Soil	RSLAWTVYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRYSRGGLVE*
Ga0157378_132242162	3300013297	Miscanthus Rhizosphere	LYQRGVVQTDYGLSSAMSVVLLVIAFVVSYFSLRYSRGALVE*
Ga0157375_116699321	3300013308	Miscanthus Rhizosphere	EQRSLAVTIYDRGVVQNDYGLASAMGMVLLAVAFVVTYFSLRYSRGALAE*
Ga0163163_109448402	3300014325	Switchgrass Rhizosphere	VVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE*
Ga0120171_11014672	3300014827	Permafrost	LYQHGIVQSDYGASAAMAVLLLLIAFVVTYFSLRYSRGALVQ*
Ga0157379_109774411	3300014968	Switchgrass Rhizosphere	QRGVISTDYGVSATMGIVLLVLAFVVTYFSLRFSRGALVE*
Ga0173480_109125532	3300015200	Soil	QNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE*
Ga0184608_102461661	3300018028	Groundwater Sediment	RALAWTLYQRGVVQGDYGIASTMSVVLLVIAFAVSYFALRYSRGALVQ
Ga0184608_103069901	3300018028	Groundwater Sediment	SLAWTLYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE
Ga0187787_100281951	3300018029	Tropical Peatland	QKGVVQNDYGLSTTMGIVLLVIAFVVSWGSLRYSRGALVD
Ga0184626_100141881	3300018053	Groundwater Sediment	NEQRSLAWTVYQRGVVQNDYGLSSTMGIVLLGIAFLVTYISLRYSRGALVE
Ga0184621_103317341	3300018054	Groundwater Sediment	RALAWTLYQRGVVQTDYGLSSAMSVVLLAIAFAVSYFSLRYSRGALVA
Ga0184618_103826321	3300018071	Groundwater Sediment	NEQKSLAWTLYQRGVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE
Ga0184640_102630942	3300018074	Groundwater Sediment	YQRGVVQTDYGLSTAMGVVLLVLAFAVTYFSLRYSRGALVE
Ga0184609_104582992	3300018076	Groundwater Sediment	DRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALIE
Ga0184627_101447941	3300018079	Groundwater Sediment	AEQRTLAWTLYQRGVVQLDYGLATAMGVILMILAFTVNYASLRYSRGGLV
Ga0210379_104635672	3300021081	Groundwater Sediment	LFQRGVVQTDYGLSTTMGVVLLILAFVVTYLSLRYSRGALVE
Ga0193706_11640401	3300021339	Soil	NRGVVQADYGLSSAMAIVLLVLAFGVSYVSIRYSRGALV
Ga0247745_10069581	3300022898	Soil	RGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALVE
Ga0209431_107038991	3300025313	Soil	SLAWTLYQRGVVQTDYGLSTAMGVVLLIFAFIVSYLSLRYSRNALVD
Ga0207653_103391772	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	QRGVVQTDYGLSSAMSVVLLVIAFIVSYFSLRYSRGALVE
Ga0207684_100316076	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	RGVVQTDYGLSTAMGVVLLGVAFVVTYLSLRYSRGALVE
Ga0207707_100571231	3300025912	Corn Rhizosphere	EQRALAWTLYQRGVVQTDYGLSSAMSVVLLIIAFIVSYFSLRYSRGALVE
Ga0207650_102077841	3300025925	Switchgrass Rhizosphere	LYQRGVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE
Ga0207706_108593421	3300025933	Corn Rhizosphere	SLAVTIYDRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE
Ga0207709_102306663	3300025935	Miscanthus Rhizosphere	GVVQTDYGLSTAMGVVLLILAFAVTYFSLRYSRGALVE
Ga0207712_119231932	3300025961	Switchgrass Rhizosphere	VQTDYGLSTAMGVVLLILAFAVTYFSLRYSHGALVE
Ga0207683_100553471	3300026121	Miscanthus Rhizosphere	NEQRSLAVTIYDRGVVQNDYGLASAMGVVLLAIAFVVTYFSLRYSRGALAE
Ga0207698_108756732	3300026142	Corn Rhizosphere	GVVQTDYGLSSAMGIVLLVIALLVSYFSLRYSRGALIE
Ga0209382_112787452	3300027909	Populus Rhizosphere	YQRGVVQTDYGLSTTMGVVLLILAFTVTYFSLRYSRGALVE
Ga0137415_110531951	3300028536	Vadose Zone Soil	NEQRALAWTLYQRGVVQTDYGLSTAMGTVLLVIAFAVTYLSLRYSRGALVE
Ga0247828_103828342	3300028587	Soil	AWTLFQRGVVQTDYGLASAMSVVLLVIAVVVSYFSLRYSRGALVD
Ga0307304_103660492	3300028885	Soil	AYTLYQRGVVQSDYGLSSAMSIVLLVLAFAVSYLSLRHSRRALI
Ga0310887_108698651	3300031547	Soil	RSLAVTIYDRGVVQNDYGLASAMGMVLLAVAFVVTYFSLRYSRGALAE
Ga0307473_114900812	3300031820	Hardwood Forest Soil	TLYQRGVVQTDYGLSTTMGVVLLVIAFVVTYFSLRFSRGALVE
Ga0310892_108300921	3300031858	Soil	VQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE
Ga0310892_111310211	3300031858	Soil	QRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALIE
Ga0315297_102254843	3300031873	Sediment	LYKRGVVENDYGLSSMMGVVLLSVAFVVTYFSLRFSRGALVD
Ga0311367_106136281	3300031918	Fen	GVVQSDYGLSSAMSIVLLVLAVVVSYVSLRYSRNALV
Ga0310903_101164073	3300032000	Soil	EQRSLAVTIYDRGVVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE
Ga0310903_105863712	3300032000	Soil	FQRGVVQTDYGLASAMSVVLLVIAVVVSYFSLRYSRGALVD
Ga0310897_106092792	3300032003	Soil	GVVQNDYGLGSAMGVVLLAIAFIVTYFSLRYSRGALAE
Ga0310890_117662031	3300032075	Soil	LYQRGVISTDYGVSATMGIVLLVVAFVVTYFSLRFSRGALVE
Ga0307470_103857412	3300032174	Hardwood Forest Soil	WTLYQRGVVQTDYGLASAMSVVLLIIAVLVSYFSLRYSRGALVD
Ga0307472_1023648921	3300032205	Hardwood Forest Soil	VVQNDYGLASAMGMVLLAIAFVVTYFSLRYSRGALAE
Ga0326730_10641321	3300033500	Peat Soil	VVENDYGLSSMMGVVLLSLAFTVTYFSLRYSRGALVE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign