NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084193

Metagenome / Metatranscriptome Family F084193

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084193
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 37 residues
Representative Sequence ERKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT
Number of Associated Samples 90
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.21 %
% of genes from short scaffolds (< 2000 bps) 82.14 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.821 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.643 % of family members)
Environment Ontology (ENVO) Unclassified
(22.321 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.036 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.56%    β-sheet: 0.00%    Coil/Unstructured: 48.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00903Glyoxalase 8.04
PF02371Transposase_20 2.68
PF07883Cupin_2 2.68
PF00583Acetyltransf_1 1.79
PF01828Peptidase_A4 1.79
PF13302Acetyltransf_3 1.79
PF12850Metallophos_2 1.79
PF08241Methyltransf_11 1.79
PF01230HIT 1.79
PF05974DUF892 0.89
PF01464SLT 0.89
PF06348DUF1059 0.89
PF01590GAF 0.89
PF13460NAD_binding_10 0.89
PF07676PD40 0.89
PF03575Peptidase_S51 0.89
PF01022HTH_5 0.89
PF12681Glyoxalase_2 0.89
PF01872RibD_C 0.89
PF01548DEDD_Tnp_IS110 0.89
PF08240ADH_N 0.89
PF13669Glyoxalase_4 0.89
PF00884Sulfatase 0.89
PF04545Sigma70_r4 0.89
PF02894GFO_IDH_MocA_C 0.89
PF06803DUF1232 0.89
PF07366SnoaL 0.89
PF01741MscL 0.89
PF01152Bac_globin 0.89
PF06441EHN 0.89
PF06224HTH_42 0.89
PF00096zf-C2H2 0.89
PF13474SnoaL_3 0.89
PF12680SnoaL_2 0.89
PF07228SpoIIE 0.89
PF01019G_glu_transpept 0.89
PF00155Aminotran_1_2 0.89
PF04794YdjC 0.89
PF05155Phage_X 0.89
PF04542Sigma70_r2 0.89
PF01636APH 0.89
PF01243Putative_PNPOx 0.89
PF00561Abhydrolase_1 0.89
PF13749HATPase_c_4 0.89
PF00211Guanylate_cyc 0.89
PF00005ABC_tran 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 3.57
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.89
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.89
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.89
COG3394Chitooligosaccharide deacetylase ChbG, YdjC/CelG familyCarbohydrate transport and metabolism [G] 0.89
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 0.89
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.89
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.89
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.89
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.89
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.89
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.89
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.89
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.89
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.89
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.89
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.89


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.82 %
UnclassifiedrootN/A15.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003994|Ga0055435_10003185All Organisms → cellular organisms → Bacteria2562Open in IMG/M
3300005529|Ga0070741_10003039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria42831Open in IMG/M
3300005529|Ga0070741_10024859Not Available8919Open in IMG/M
3300005529|Ga0070741_10070398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3948Open in IMG/M
3300005529|Ga0070741_10153248All Organisms → cellular organisms → Bacteria2311Open in IMG/M
3300005764|Ga0066903_108284610All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006581|Ga0074048_10095357All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300006844|Ga0075428_101116493All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300009012|Ga0066710_102415011All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300009012|Ga0066710_102930248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300009789|Ga0126307_10275333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1353Open in IMG/M
3300009840|Ga0126313_10074857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans rumicis2442Open in IMG/M
3300009840|Ga0126313_10632339All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300009840|Ga0126313_11114720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300009840|Ga0126313_11195396Not Available626Open in IMG/M
3300009840|Ga0126313_11424500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300010036|Ga0126305_10071187All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300010036|Ga0126305_10309651All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300010036|Ga0126305_10388832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium918Open in IMG/M
3300010037|Ga0126304_10186878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1352Open in IMG/M
3300010037|Ga0126304_10782587Not Available647Open in IMG/M
3300010038|Ga0126315_10355149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300010039|Ga0126309_11225460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 21-64-8516Open in IMG/M
3300010041|Ga0126312_10766199All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010042|Ga0126314_10265481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1220Open in IMG/M
3300010042|Ga0126314_11074569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300010044|Ga0126310_10025158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3047Open in IMG/M
3300010166|Ga0126306_10143916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1765Open in IMG/M
3300010166|Ga0126306_11116560All Organisms → cellular organisms → Bacteria → Terrabacteria group646Open in IMG/M
3300010322|Ga0134084_10474910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300010323|Ga0134086_10195659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → unclassified Rhodothermales → Rhodothermales bacterium753Open in IMG/M
3300010366|Ga0126379_13566968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300011003|Ga0138514_100001609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2846Open in IMG/M
3300012003|Ga0120163_1130212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300012014|Ga0120159_1046437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1395Open in IMG/M
3300012043|Ga0136631_10021532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2328Open in IMG/M
3300012094|Ga0136638_10040537All Organisms → cellular organisms → Bacteria1877Open in IMG/M
3300012186|Ga0136620_10104145All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300012186|Ga0136620_10272145All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300012201|Ga0137365_10306947Not Available1175Open in IMG/M
3300012204|Ga0137374_10499880All Organisms → cellular organisms → Bacteria → Terrabacteria group945Open in IMG/M
3300012350|Ga0137372_10398936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1042Open in IMG/M
3300012350|Ga0137372_10779402All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300012350|Ga0137372_11004785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300012360|Ga0137375_10267041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1569Open in IMG/M
3300012679|Ga0136616_10186967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium960Open in IMG/M
3300012680|Ga0136612_10318471All Organisms → cellular organisms → Bacteria → Terrabacteria group789Open in IMG/M
3300012941|Ga0162652_100018817All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300013100|Ga0157373_11204465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300013100|Ga0157373_11235606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300013296|Ga0157374_12809704Not Available514Open in IMG/M
3300013501|Ga0120154_1041490All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300013501|Ga0120154_1128572All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300014031|Ga0120173_1049929All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300014325|Ga0163163_12012575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300015359|Ga0134085_10599074Not Available512Open in IMG/M
3300015373|Ga0132257_102055158All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium737Open in IMG/M
3300015374|Ga0132255_100304999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2293Open in IMG/M
3300017695|Ga0180121_10400772Not Available533Open in IMG/M
3300017966|Ga0187776_11565631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300018028|Ga0184608_10016272Not Available2628Open in IMG/M
3300018052|Ga0184638_1009379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3279Open in IMG/M
3300018052|Ga0184638_1327098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300018054|Ga0184621_10156894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300018075|Ga0184632_10033312All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300018078|Ga0184612_10200307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300018469|Ga0190270_11657307All Organisms → cellular organisms → Bacteria → Terrabacteria group692Open in IMG/M
3300018476|Ga0190274_13069690Not Available561Open in IMG/M
3300018482|Ga0066669_12385134Not Available507Open in IMG/M
3300019869|Ga0193705_1083023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300019875|Ga0193701_1079341All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300019888|Ga0193751_1071968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1409Open in IMG/M
3300021445|Ga0182009_10400993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300022756|Ga0222622_10407532All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300025327|Ga0209751_10694232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300025552|Ga0210142_1004199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2644Open in IMG/M
3300025854|Ga0209176_10158986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300025906|Ga0207699_11463551All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025910|Ga0207684_11747204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300025921|Ga0207652_11624178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300025929|Ga0207664_11302067All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300025932|Ga0207690_11603215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300025981|Ga0207640_12077009Not Available515Open in IMG/M
(restricted) 3300027799|Ga0233416_10095289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1015Open in IMG/M
3300027857|Ga0209166_10491894Not Available631Open in IMG/M
3300028573|Ga0265334_10101374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1042Open in IMG/M
3300028705|Ga0307276_10103119Not Available692Open in IMG/M
3300028715|Ga0307313_10179262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300028720|Ga0307317_10013013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2491Open in IMG/M
3300028744|Ga0307318_10272015Not Available592Open in IMG/M
3300028778|Ga0307288_10135775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium918Open in IMG/M
3300028787|Ga0307323_10223817Not Available679Open in IMG/M
3300028791|Ga0307290_10220442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300028802|Ga0307503_10004632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3576Open in IMG/M
3300028814|Ga0307302_10224166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria919Open in IMG/M
3300028819|Ga0307296_10173418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1168Open in IMG/M
3300028819|Ga0307296_10626660Not Available589Open in IMG/M
3300028824|Ga0307310_10456278Not Available640Open in IMG/M
3300028872|Ga0307314_10203206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300028878|Ga0307278_10172842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium966Open in IMG/M
3300028884|Ga0307308_10215071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300028885|Ga0307304_10103170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1142Open in IMG/M
3300028885|Ga0307304_10563666All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300029957|Ga0265324_10275010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300031450|Ga0272433_10000719All Organisms → cellular organisms → Bacteria66730Open in IMG/M
3300031473|Ga0272434_1000264All Organisms → cellular organisms → Bacteria131616Open in IMG/M
3300031473|Ga0272434_1088527All Organisms → cellular organisms → Bacteria2234Open in IMG/M
3300031781|Ga0318547_10492019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300031901|Ga0307406_10605968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300032089|Ga0318525_10058586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1922Open in IMG/M
3300032261|Ga0306920_103282795All Organisms → cellular organisms → Bacteria → Terrabacteria group604Open in IMG/M
3300032783|Ga0335079_11694466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.64%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil16.96%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand6.25%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.36%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.46%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.68%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock2.68%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.79%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.79%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.89%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.89%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.89%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012679Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014031Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031473Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nordEnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ga0055435_1000318513300003994Natural And Restored WetlandsKQAEGKSRREAIRCLKRLLVRVVFNTLKSSPALTKEQHSRS*
Ga0070741_1000303913300005529Surface SoilKQAEGKSRREALRCLKRQLARTIYTTLKNQPLLT*
Ga0070741_1002485913300005529Surface SoilRKQAEGKSRREALRCLKRQLARTIYTTLKNQPLLT*
Ga0070741_1007039863300005529Surface SoilERKQSEGKSRREAIRCLKRQLARTVYTTHKSEPLLT*
Ga0070741_1015324843300005529Surface SoilERKRAEGKSRREALRCLKRLLIRVVFNTLKTSPALT*
Ga0066903_10828461023300005764Tropical Forest SoilYLERKRAEGKSWREAIRCLKRLLVRVVFQTLKTSPALT*
Ga0074048_1009535713300006581SoilLERKQAEGKSRREAIRCLKRLLVRVVFNTLKASPALT*
Ga0075428_10111649313300006844Populus RhizosphereERKRGEGKSRREAIRCLKRQLARVVFNTLKAEPALT*
Ga0066710_10241501133300009012Grasslands SoilERKQSEGKSRREALRCLKRQLVRTVYTTLKSESALT
Ga0066710_10293024813300009012Grasslands SoilRKQAEGKSRREAIRCVKRQLARVVFNTLKANPALT
Ga0126307_1027533313300009789Serpentine SoilLERKQADGKSRREALRCLKRQLARTVYTTLKNEPALT*
Ga0126313_1007485713300009840Serpentine SoilRKQSEGKSRREALRCLKRQLARTVFTTLKNESALT*
Ga0126313_1063233933300009840Serpentine SoilRKQAEGKSRREAIRCLKRQLARVIFNTLKASPALT*
Ga0126313_1111472013300009840Serpentine SoilLERKRNEGKSRREALRCLKRQLARTVYTTLKTESALT*
Ga0126313_1119539613300009840Serpentine SoilKQSEGKSRREALRCLKRQLARTVFTTLKNESALT*
Ga0126313_1142450023300009840Serpentine SoilERKRNEGKSRREALRCLKRQLARTVYTTLKTESALT*
Ga0126305_1007118743300010036Serpentine SoilKQADGKSRREALRCLKRQLARTVYTTLKNEPALT*
Ga0126305_1030965113300010036Serpentine SoilKQGEGKSRREAIRCLKRLLVRVAFNTLKTSPALT*
Ga0126305_1038883233300010036Serpentine SoilAYLERKQGEGKSRREAIRCLKRQLARTVYTTLKSEPSLT*
Ga0126304_1018687813300010037Serpentine SoilKQAEGKSRREAIRCLKRQLARVVFNTLKASPTLT*
Ga0126304_1078258723300010037Serpentine SoilYLERKQAEGKSRREAIRCLKRTLARVVFNTLKASPALT*
Ga0126315_1035514933300010038Serpentine SoilKQGEGKSRREALRCLKRQLARTVYTTLKSEPSLT*
Ga0126309_1122546023300010039Serpentine SoilRKRSEGKSRREALRCLKRLLVRVVFQTLKTSPALT*
Ga0126312_1076619913300010041Serpentine SoilKQAEGKSRREALRCLKRQLARTVYTTLKTESALT*
Ga0126314_1026548113300010042Serpentine SoilRKQAEGKSRREAIRCLKRPLVRVVFNTLKTSPALT*
Ga0126314_1107456913300010042Serpentine SoilYLERKQAEGKSRREAIRCLKRQLVRVVFNTLKASPALT*
Ga0126310_1002515853300010044Serpentine SoilKQAAGKSRREAIRCLKRLLVRVVFNTLKASPALT*
Ga0126306_1014391633300010166Serpentine SoilERKQAEGKSRREAIRCLKRQLARVVFNTLKASPTLT*
Ga0126306_1111656023300010166Serpentine SoilKQAEGKSRREALRCLKRQLARTVYTTLKNEPLLT*
Ga0134084_1047491023300010322Grasslands SoilLERKRAEGKSRREALRCLKRLLVRVVFNTLKASPALT*
Ga0134086_1019565913300010323Grasslands SoilKRAEGKSRREALRCLRRLLVRVVFNTLEASRALT*
Ga0126379_1356696813300010366Tropical Forest SoilRKRAEGKSWREAIRCLKRLLVRVVFQTLKTSPALT*
Ga0138514_10000160983300011003SoilLERKQGEGKSRREAIRCLKRQLARTVYTTLKSEPSLT*
Ga0120163_113021213300012003PermafrostAARASLARKQADGKSRREALRCLKRQLARTVYTILKSEPLLT*
Ga0120159_104643733300012014PermafrostSPPPPRPSPKRKQAEGKSKREAIRCLKRQLIRVVFNTLKASPTLT*
Ga0136631_1002153213300012043Polar Desert SandLERKQAEGKSKREAIRCLKRLLARTVFNALKASPALT*
Ga0136638_1004053713300012094Polar Desert SandRKQAEGKSRREAIRCLKRQLARTVHTILKKKPLLT*
Ga0136620_1010414513300012186Polar Desert SandLERKQAEGKSRREAIRCLKRMLVRVVFNTLKASPTLT*
Ga0136620_1027214523300012186Polar Desert SandKQAEGKSRREAIRCLKRQLARTIFNTLKASPTLT*
Ga0137365_1030694723300012201Vadose Zone SoilERKQSEGKSRREALRCLKRQLARTVYTTLKNEPLLT*
Ga0137374_1049988013300012204Vadose Zone SoilKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT*
Ga0137372_1039893623300012350Vadose Zone SoilLERKQGEGKSRREAIRCLKRQLARTVYTTLKSESALT*
Ga0137372_1077940213300012350Vadose Zone SoilKQAEGKSRREAIRCLKRQLVRVVFNTLKASPALT*
Ga0137372_1100478513300012350Vadose Zone SoilKQSEGKSRREALRCLKRQLARTVYTTLKNEPLLT*
Ga0137375_1026704113300012360Vadose Zone SoilERKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT*
Ga0136616_1018696723300012679Polar Desert SandKQAEGKSRREALRCLKRQLARTIFNTLKARPTLT*
Ga0136612_1031847113300012680Polar Desert SandKQAEGKSRREAIRCLKRQLARTVYTTLKANPTLT*
Ga0162652_10001881713300012941SoilAYLERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT*
Ga0157373_1120446513300013100Corn RhizosphereRKQAEGKTRREALRCLKRQLARTVYTTLKSELLLT*
Ga0157373_1123560613300013100Corn RhizosphereERKQAEGKTRREAIRCLKRLLARVVFNTLKTSPALT*
Ga0157374_1280970423300013296Miscanthus RhizosphereARAYLERKRGEGKSWREAIRCHKRLLVRVVFQTLKASPALT*
Ga0120154_104149013300013501PermafrostEPPPSPDRNQAEGKTRREAIRCLKRLLARAVFNTLKASPTLT*
Ga0120154_112857213300013501PermafrostSPPAPRACLERKQAEGKSKREAIRCLKRLLARTVFNTLKASPALT*
Ga0120173_104992923300014031PermafrostAYLERKQAEGKTRREAISCLKRQLARTVFNTLKANTALT*
Ga0163163_1201257523300014325Switchgrass RhizosphereMELKQTEGKSRREGLRSLKRHLARTIHTTLKNEAALT*
Ga0134085_1059907423300015359Grasslands SoilMTTSSTSSRKQAEGKSRREAIRCLKRQLARTVFNTLKAGTALT*
Ga0132257_10205515833300015373Arabidopsis RhizosphereHPPARAYLERKQNEGKSRREALHCLKRQLARTVYTTLKNEPY*
Ga0132255_10030499913300015374Arabidopsis RhizosphereKQAEGKSRREAIRCLKRQLARTVYTTLKAEPALT*
Ga0180121_1040077223300017695Polar Desert SandERKQAEGKTRREAIRCLKRLLARTVFNTLKASPALT
Ga0187776_1156563113300017966Tropical PeatlandNANAAKGKSRREALRCLKRLLVRVVYNTLKTSPALT
Ga0184608_1001627213300018028Groundwater SedimentRKQGEGKTRREAIRCLKRQLARTVYTTLKNEPLLT
Ga0184638_100937973300018052Groundwater SedimentERKQAEGKSRREAIRCLKRQLARTVYTTLKNAPLLT
Ga0184638_132709813300018052Groundwater SedimentLERKQAEGKSRREAIRCLKRQLARTVYTTLKNAPLLT
Ga0184621_1015689413300018054Groundwater SedimentERKQNEGKSRREAIRCLKRQLARTVYTTLKTESALT
Ga0184632_1003331213300018075Groundwater SedimentRKQAEGKSRREAIRCLKRQLARTVYTTLKNAPLLT
Ga0184612_1020030733300018078Groundwater SedimentERKQSEGKSRREALRCLKRQLARTVYTTLKAESALT
Ga0190270_1165730723300018469SoilERKQSEGKSRREALRCLKRQLARTIFNTLKASPALT
Ga0190274_1306969023300018476SoilERKQADGKSRREAIRCLKRQLARTIYTTLKNEPRLT
Ga0066669_1238513413300018482Grasslands SoilERKQNEGKSRREAIRCLKRQLARTIYTTLKTEPLLT
Ga0193705_108302313300019869SoilLERKQAEGKSRREAIRCLKRLLVRVVFNTLKASPALT
Ga0193701_107934123300019875SoilERKQGEGKSRREALRCLKRLLARTVYTTLKSEALLT
Ga0193751_107196823300019888SoilAYLERKQAEGKSRREAIRCLKRLLVRVVFNTLKTSPALT
Ga0182009_1040099313300021445SoilERKQAEGKSRREAIRCLKRQLARVVFNTLKASPALT
Ga0222622_1040753213300022756Groundwater SedimentRKQAEGKSRREAIRCLKRQLARAVFNTLKTSPALT
Ga0209751_1069423223300025327SoilRKQAEGKSRREAIRCLKRLLVRVVFNTLKASPALT
Ga0210142_100419913300025552Natural And Restored WetlandsERKQSEGKSRREALRCLKRQLARTVYTTLKSEPLLT
Ga0209176_1015898623300025854Arctic Peat SoilLERKRADGKTKREAIRCLKRLLARTVFNTLKASAALT
Ga0207699_1146355123300025906Corn, Switchgrass And Miscanthus RhizosphereAYLDRKQNEGKTRREAIRCLKRQLARTVYTTLRDQPLLT
Ga0207684_1174720423300025910Corn, Switchgrass And Miscanthus RhizosphereERKQGEGKSRREALRCLKRQLARTVYTTLKNEPLLT
Ga0207652_1162417813300025921Corn RhizosphereYLERKQAEGKSRREAIRCLKRLLVRVVFNTLKTSPALT
Ga0207664_1130206723300025929Agricultural SoilRKQTEGKSRREAIRCLKRQLARVVFNTLKASPALT
Ga0207690_1160321523300025932Corn RhizosphereYLERKRGEGKSRREAIRCLKRLLVRVVFNTLKASPALT
Ga0207640_1207700913300025981Corn RhizospherePARDYLERKRAEGKRMRSTRCLKRRLVRVIFNTLKASPP
(restricted) Ga0233416_1009528933300027799SedimentLERKQSEGKSRREAIRCLKRQLARTVYTTLKAESALT
Ga0209166_1049189413300027857Surface SoilYLDRKQAEGKSRREAIRCLKRLLIRAVYQSLKTSPTLT
Ga0265334_1010137413300028573RhizosphereRKQAEGKSRREALRCLKRQLARTIYTTLKNQPHLT
Ga0307276_1010311923300028705SoilRVPTSERKQSEGKSRREALRCLKRQLARTVYTTLKKESLLT
Ga0307313_1017926223300028715SoilRKQNEGKTRREAIRCLKRQLARTVYTTLKSEPLLT
Ga0307317_1001301363300028720SoilRKQGEGKSRREALRCLKRLLARTVYTTLKSEALLT
Ga0307318_1027201513300028744SoilERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT
Ga0307288_1013577513300028778SoilYLARKQTEGKSRREALRCLKRQLARTVYTTLKNEPPLT
Ga0307323_1022381713300028787SoilLERKQGEGKTRREAIRCLKRQLARTVYTTLKNEPLLT
Ga0307290_1022044223300028791SoilYLERKQGEGKTRREAIRCLKRQLARTVYTTLKNEPQLT
Ga0307503_1000463213300028802SoilERKQNEGKSRREALRCLKRQLARTVYTTLKNEPPLT
Ga0307302_1022416623300028814SoilRKQTEGKSRREALRCLKRQLARTVYTTLKNEPPLT
Ga0307296_1017341833300028819SoilRKQSEGKSRREALRCLKRQLARIVFNTLKASPALT
Ga0307296_1062666023300028819SoilLQRKQNEGKTRREAIRCLKRQLARTVYTTLKSEPLLT
Ga0307310_1045627813300028824SoilRKQNEGKTRREAIRCLKRQLARTVYTTLKTEPLLT
Ga0307314_1020320623300028872SoilYLERKQNEGKSRREAIRCLKRQLARTVYTTLKTESALT
Ga0307278_1017284213300028878SoilERKQSQGKTRREAIRCLKRQLARTVYTTLKNEPLLT
Ga0307308_1021507113300028884SoilRKQGEGKSRREALRCLKRQLARTVYTTLKSEALLT
Ga0307304_1010317023300028885SoilVYLERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT
Ga0307304_1056366613300028885SoilLERKQTEGKSRREAIRCLKRQLARVVFNTLKASPVLT
Ga0265324_1027501013300029957RhizosphereERKQAEGKSRREALRCLKRQLARTIYTTLKNQPHLT
Ga0272433_10000719803300031450RockARKQTEGKSRREALRCLKRQLARTVYTTLKNEPPLT
Ga0272434_10002641433300031473RockLARKQTEGKSRREAIRCLKRQLARTVHTTLKNGPPLT
Ga0272434_108852753300031473RockARKQTEGKSRREAIRCLKRQLARTVHTTLKNGPPLT
Ga0318547_1049201913300031781SoilERKKAEGKSRREAIRCLKRLLVRVVFNTLKASPALT
Ga0307406_1060596813300031901RhizosphereRTQREGKSRREALRCLKRQLARTVYTTLKSEPSLT
Ga0318525_1005858613300032089SoilRKQNEGKTRREAIRCLKRQLARTVYTTLKNEPLLT
Ga0306920_10328279513300032261SoilYHEGKRADGKSRREAIRCLKRLLVRVVYQTLKASPALT
Ga0335079_1169446623300032783SoilERKQGEGKSRREALRCLKRQLARTVYTTLKSEPLLT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.