Basic Information | |
---|---|
Family ID | F083737 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 112 |
Average Sequence Length | 41 residues |
Representative Sequence | MTKARDLANASTALSAVSATELGYVDGVTSAIQTQIDAKA |
Number of Associated Samples | 71 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 99.11 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 84.82 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Predicted Viral (33.929 % of family members) |
NCBI Taxonomy ID | 10239 (predicted) |
Taxonomy | All Organisms → Viruses → Predicted Viral |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (45.536 % of family members) |
Environment Ontology (ENVO) | Unclassified (67.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.571 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF01476 | LysM | 0.89 |
PF09723 | Zn-ribbon_8 | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.75 % |
Unclassified | root | N/A | 31.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10013693 | All Organisms → Viruses → Predicted Viral | 3078 | Open in IMG/M |
3300002408|B570J29032_109330293 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300002835|B570J40625_100243919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1882 | Open in IMG/M |
3300003394|JGI25907J50239_1018292 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
3300003734|Ga0008279_1029293 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005517|Ga0070374_10328060 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300005527|Ga0068876_10027487 | All Organisms → cellular organisms → Bacteria | 3555 | Open in IMG/M |
3300005583|Ga0049085_10272140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300005583|Ga0049085_10272209 | Not Available | 553 | Open in IMG/M |
3300007516|Ga0105050_10781557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 545 | Open in IMG/M |
3300007708|Ga0102859_1124722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 749 | Open in IMG/M |
3300007722|Ga0105051_11066804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 577 | Open in IMG/M |
3300007960|Ga0099850_1313410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300007973|Ga0105746_1278115 | Not Available | 579 | Open in IMG/M |
3300008107|Ga0114340_1000902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20078 | Open in IMG/M |
3300008107|Ga0114340_1016077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6436 | Open in IMG/M |
3300008107|Ga0114340_1016186 | All Organisms → Viruses → Predicted Viral | 3569 | Open in IMG/M |
3300008107|Ga0114340_1266443 | Not Available | 512 | Open in IMG/M |
3300008110|Ga0114343_1166233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 683 | Open in IMG/M |
3300008110|Ga0114343_1187050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300008120|Ga0114355_1102267 | Not Available | 1123 | Open in IMG/M |
3300008261|Ga0114336_1106958 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
3300008266|Ga0114363_1226596 | Not Available | 548 | Open in IMG/M |
3300008339|Ga0114878_1139776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300008448|Ga0114876_1014987 | All Organisms → Viruses → Predicted Viral | 4219 | Open in IMG/M |
3300008448|Ga0114876_1028024 | All Organisms → Viruses → Predicted Viral | 2798 | Open in IMG/M |
3300008448|Ga0114876_1052327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 1835 | Open in IMG/M |
3300008448|Ga0114876_1167482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300008448|Ga0114876_1174220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300009163|Ga0114970_10665599 | Not Available | 555 | Open in IMG/M |
3300009181|Ga0114969_10096385 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
3300010160|Ga0114967_10433698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10088456 | All Organisms → cellular organisms → Bacteria | 2682 | Open in IMG/M |
3300013372|Ga0177922_10846378 | All Organisms → Viruses → Predicted Viral | 2383 | Open in IMG/M |
3300013372|Ga0177922_10908895 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
3300017701|Ga0181364_1027650 | Not Available | 922 | Open in IMG/M |
3300017722|Ga0181347_1017137 | All Organisms → Viruses → Predicted Viral | 2309 | Open in IMG/M |
3300017723|Ga0181362_1028747 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
3300017723|Ga0181362_1051009 | Not Available | 860 | Open in IMG/M |
3300017736|Ga0181365_1078794 | Not Available | 808 | Open in IMG/M |
3300017736|Ga0181365_1089392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 750 | Open in IMG/M |
3300017736|Ga0181365_1097839 | Not Available | 712 | Open in IMG/M |
3300017747|Ga0181352_1095720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300017761|Ga0181356_1026402 | Not Available | 2102 | Open in IMG/M |
3300017774|Ga0181358_1038696 | All Organisms → Viruses → Predicted Viral | 1840 | Open in IMG/M |
3300017774|Ga0181358_1044734 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
3300017774|Ga0181358_1052171 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
3300017774|Ga0181358_1073940 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
3300017774|Ga0181358_1074777 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
3300017774|Ga0181358_1078178 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
3300017774|Ga0181358_1110627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300017774|Ga0181358_1187360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 684 | Open in IMG/M |
3300017777|Ga0181357_1061471 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
3300017777|Ga0181357_1062150 | All Organisms → Viruses → Predicted Viral | 1445 | Open in IMG/M |
3300017777|Ga0181357_1148683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 864 | Open in IMG/M |
3300017777|Ga0181357_1321512 | Not Available | 520 | Open in IMG/M |
3300017778|Ga0181349_1158192 | Not Available | 809 | Open in IMG/M |
3300017780|Ga0181346_1301694 | Not Available | 543 | Open in IMG/M |
3300017784|Ga0181348_1056420 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
3300017784|Ga0181348_1068102 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
3300017784|Ga0181348_1159292 | Not Available | 839 | Open in IMG/M |
3300017785|Ga0181355_1064658 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
3300017785|Ga0181355_1075354 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
3300017785|Ga0181355_1186698 | Not Available | 821 | Open in IMG/M |
3300017785|Ga0181355_1209489 | Not Available | 762 | Open in IMG/M |
3300019784|Ga0181359_1039609 | All Organisms → Viruses → Predicted Viral | 1825 | Open in IMG/M |
3300019784|Ga0181359_1048835 | Not Available | 1633 | Open in IMG/M |
3300019784|Ga0181359_1085377 | Not Available | 1177 | Open in IMG/M |
3300019784|Ga0181359_1134206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300019784|Ga0181359_1163127 | Not Available | 753 | Open in IMG/M |
3300019784|Ga0181359_1196248 | Not Available | 654 | Open in IMG/M |
3300019784|Ga0181359_1259521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300020159|Ga0211734_10616395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300022190|Ga0181354_1059825 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
3300022407|Ga0181351_1061597 | All Organisms → Viruses → Predicted Viral | 1541 | Open in IMG/M |
3300022407|Ga0181351_1070860 | Not Available | 1411 | Open in IMG/M |
3300023174|Ga0214921_10505015 | Not Available | 573 | Open in IMG/M |
3300023184|Ga0214919_10314479 | Not Available | 1070 | Open in IMG/M |
3300025647|Ga0208160_1077915 | Not Available | 892 | Open in IMG/M |
3300027155|Ga0255081_1063842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300027491|Ga0255097_1061486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300027581|Ga0209651_1195847 | Not Available | 530 | Open in IMG/M |
3300027679|Ga0209769_1065932 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
3300027732|Ga0209442_1252828 | Not Available | 629 | Open in IMG/M |
3300027756|Ga0209444_10035837 | All Organisms → Viruses → Predicted Viral | 2337 | Open in IMG/M |
3300027759|Ga0209296_1008677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6225 | Open in IMG/M |
3300027785|Ga0209246_10042735 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
3300027798|Ga0209353_10466801 | Not Available | 507 | Open in IMG/M |
3300027808|Ga0209354_10167029 | Not Available | 896 | Open in IMG/M |
3300027816|Ga0209990_10125938 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
3300027963|Ga0209400_1026760 | All Organisms → Viruses → Predicted Viral | 3271 | Open in IMG/M |
3300027983|Ga0209284_10350577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300028025|Ga0247723_1132762 | Not Available | 598 | Open in IMG/M |
3300028108|Ga0256305_1176059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 507 | Open in IMG/M |
3300029930|Ga0119944_1017564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300031758|Ga0315907_10170985 | All Organisms → Viruses → Predicted Viral | 1833 | Open in IMG/M |
3300031758|Ga0315907_10264772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
3300031857|Ga0315909_10050315 | All Organisms → Viruses → Predicted Viral | 3864 | Open in IMG/M |
3300031857|Ga0315909_10354812 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
3300031951|Ga0315904_10179259 | Not Available | 2106 | Open in IMG/M |
3300031951|Ga0315904_10190221 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
3300031951|Ga0315904_10221528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus → Siovirus germanense | 1838 | Open in IMG/M |
3300031951|Ga0315904_10435566 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
3300032050|Ga0315906_10540752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300032092|Ga0315905_11537348 | Not Available | 520 | Open in IMG/M |
3300032116|Ga0315903_10275136 | All Organisms → Viruses → Predicted Viral | 1439 | Open in IMG/M |
3300033981|Ga0334982_0272511 | Not Available | 806 | Open in IMG/M |
3300034062|Ga0334995_0135530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1801 | Open in IMG/M |
3300034062|Ga0334995_0706602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300034092|Ga0335010_0288983 | Not Available | 947 | Open in IMG/M |
3300034118|Ga0335053_0234832 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
3300034279|Ga0335052_0096960 | Not Available | 1781 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 45.54% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.04% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.04% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.68% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.68% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.79% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.89% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.89% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.89% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.89% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003734 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100136931 | 3300000756 | Freshwater And Sediment | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQ |
B570J29032_1093302931 | 3300002408 | Freshwater | MSKARDIASAAPAPSTVSATELGYVDGVTSAIQTQLD |
B570J40625_1002439191 | 3300002835 | Freshwater | MTKARDIASAAPAPSTVSATELGYLDGVTSAIQTQLDAKTAKSTL |
JGI25907J50239_10182923 | 3300003394 | Freshwater Lake | MTKARDLANAGTALGAVSATELAFVDGVTSAIQTQIDSKIGSASAIN |
Ga0008279_10292932 | 3300003734 | Marine | MTKARDLANYVSAGTVDSTELGYLDGVTSNIQDQLDNISVTS |
Ga0070374_103280601 | 3300005517 | Freshwater Lake | MTKARDLANSAAAFAAVSATELAFVDGVTSAIQTQIDAKAPSSTAVTLTGTQTL |
Ga0068876_100274871 | 3300005527 | Freshwater Lake | MTKARDIASATPAPSTVSATELGYLDGVSSAIQTQ |
Ga0049085_102721401 | 3300005583 | Freshwater Lentic | MTKARDLANSAAAFSAVSATELGYVDGVTSAIQTQLDA |
Ga0049085_102722091 | 3300005583 | Freshwater Lentic | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSSTAVTLT |
Ga0105050_107815571 | 3300007516 | Freshwater | MTKARDIASAIPAPATVSSVELGYLDGVTSAIQTQVDS |
Ga0102859_11247222 | 3300007708 | Estuarine | MSKARDLANAGTALTTVSATELGFLDGVTSAVQTQVDAK |
Ga0105051_110668041 | 3300007722 | Freshwater | MTKARDIASAIPAPATVSSVELGYLDGVTSAIQTQVDSKIGSA |
Ga0099850_13134103 | 3300007960 | Aqueous | MSKARDLANAGTALTTVDATELGYLDGVTSAVQTQIDTKAPSS |
Ga0105746_12781151 | 3300007973 | Estuary Water | LTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKASL |
Ga0114340_100090221 | 3300008107 | Freshwater, Plankton | MSKARDLANAASALSAVSATELGYIDGVTSAIQTQINTVNTSV |
Ga0114340_10160771 | 3300008107 | Freshwater, Plankton | MSKARDLANAGTALGAVTATELGYVDGVTSAIQTQIDSKIGSA |
Ga0114340_10161864 | 3300008107 | Freshwater, Plankton | MTKARDLANAASALSAVSATELGYIDGVTSAIQTQINTVNTSV |
Ga0114340_12664431 | 3300008107 | Freshwater, Plankton | MSKARDLANAGTALTSVSATELGYLDGVTSAVQTQIN |
Ga0114343_11662331 | 3300008110 | Freshwater, Plankton | MSKARDLANAGTALTTVSATELGYLDGVTSAVQTQINAQIPK |
Ga0114343_11870503 | 3300008110 | Freshwater, Plankton | MSKARDLANAGTALTTVSATELGYLDGVTSAVQTQINSK |
Ga0114355_11022674 | 3300008120 | Freshwater, Plankton | MTKARDIASAAPAPSTVSATELGYLDGVSSAIQTQIDSKIGSASAIN |
Ga0114336_11069581 | 3300008261 | Freshwater, Plankton | MSKARDLANAGTALTTVSATELGYLDGVTSAVQTQIDSKIGSASAI |
Ga0114363_12265962 | 3300008266 | Freshwater, Plankton | MTKARDLASAAPAPSTVSATELGYLDGVTSNIQTQIDSKTGGIATDTPP |
Ga0114878_11397763 | 3300008339 | Freshwater Lake | MSKARDIASAAPAPSTVSATELGYVDGVTSAIQTQL |
Ga0114876_10149876 | 3300008448 | Freshwater Lake | MTKARDIASATPAPSTVSATELGYLDGVSSAIQTQIDSKIGSASAIN |
Ga0114876_10280247 | 3300008448 | Freshwater Lake | MSKARDIASATPAPSTVSATELGYLDGVSSAIQTQIDSKIGSASAIN |
Ga0114876_10523275 | 3300008448 | Freshwater Lake | MSKARDLASATPAPSTVSATELGYLDGVTSAVQTQIDSKIGSASAIN |
Ga0114876_11674821 | 3300008448 | Freshwater Lake | MTKARDLANASTALSAVDATELGYLDGVTSNIQTQFSN |
Ga0114876_11742202 | 3300008448 | Freshwater Lake | MTKARDLANAATALSAVSATELAYLDGVTSAIQTQINTKAATTYVD |
Ga0114970_106655993 | 3300009163 | Freshwater Lake | MSKARDLANIATTLATVSTTELGYVDGVTSPIQTQINNIDATP |
Ga0114969_100963855 | 3300009181 | Freshwater Lake | MTKARDLANASTALSAVSATELGYVDGVTSAIQTQIDAKA |
Ga0114967_104336983 | 3300010160 | Freshwater Lake | MTKARDLANAGTALGAVSATELGYVDGVTSAIQTQ |
(restricted) Ga0172372_100884561 | 3300013132 | Freshwater | MSKARDIASAAPAPSTVSATEIGYLDGVSSAIQTQLDGKTAKNTL |
Ga0177922_108463781 | 3300013372 | Freshwater | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQIDAKAPSSTAVTLT |
Ga0177922_109088951 | 3300013372 | Freshwater | MSKARDIASAAPAPSTVSATELGYVDGVTSAIQTQID |
Ga0181364_10276501 | 3300017701 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPS |
Ga0181347_10171371 | 3300017722 | Freshwater Lake | MTKARDLANAGTALGAVSATELAFVDGVTSAIQTQ |
Ga0181362_10287471 | 3300017723 | Freshwater Lake | MSKARDLANAGTALGAVTATELGYVDGVTSAIQTHLS |
Ga0181362_10510091 | 3300017723 | Freshwater Lake | MTKARDLANASTALSAVSATELAFLDGVTSAVQTQIDGKQAVNANV |
Ga0181365_10787941 | 3300017736 | Freshwater Lake | MTKARDLANAGTALGAVSATELAFVDGVTSAIQAQMD |
Ga0181365_10893921 | 3300017736 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSS |
Ga0181365_10978393 | 3300017736 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKA |
Ga0181352_10957201 | 3300017747 | Freshwater Lake | MTKARDLASAAPAPSTVSATEIGYLDGVSSAIQTQ |
Ga0181356_10264021 | 3300017761 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQI |
Ga0181358_10386965 | 3300017774 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAK |
Ga0181358_10447341 | 3300017774 | Freshwater Lake | MSKARDLANAGTALGAVTATELAFVDGVTSAIQTQIDSKIGS |
Ga0181358_10521711 | 3300017774 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKALSSTAVTL |
Ga0181358_10739401 | 3300017774 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQM |
Ga0181358_10747774 | 3300017774 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSSTAVTL |
Ga0181358_10781783 | 3300017774 | Freshwater Lake | MTKARDLANASTALSAVSATELAFIDGATSNIQTQLDNVK |
Ga0181358_11106271 | 3300017774 | Freshwater Lake | MTKARDLANAGTALGAVTATELAFVDGVTSAIQTQIDSKIGS |
Ga0181358_11873601 | 3300017774 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQIDAKAPSSTAAT |
Ga0181357_10614715 | 3300017777 | Freshwater Lake | MSKARDLANAGTALGAVSATELAFVDGVTSAIQTQIDAKT |
Ga0181357_10621504 | 3300017777 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSST |
Ga0181357_11486831 | 3300017777 | Freshwater Lake | MSKARDLANASTALSAVSATELAFVDGVTSAIQTQI |
Ga0181357_13215123 | 3300017777 | Freshwater Lake | MTKARDLANSAAAFASVSATELAFVDGVTSAIQTQMDAKAPS |
Ga0181349_11581922 | 3300017778 | Freshwater Lake | MTKARDLANASTALSAVSATELAFIDGATSNIQTQL |
Ga0181346_13016942 | 3300017780 | Freshwater Lake | MSKARDIASAIPAPSTVSSAELGYLDGVTSAIQTQLDAKTAKST |
Ga0181348_10564201 | 3300017784 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSSTA |
Ga0181348_10681021 | 3300017784 | Freshwater Lake | MTKARDIASAIPAPSTVSSAELGFLDGVTSAIQTQMDAKAASSTAVT |
Ga0181348_11592921 | 3300017784 | Freshwater Lake | MTKARDLANASTALSAVSATELAFIDGATSNIQTQLDN |
Ga0181355_10646581 | 3300017785 | Freshwater Lake | MTKARDIASAIPAPSTVDATELGYLDGVTSAIQTQIDAKT |
Ga0181355_10753544 | 3300017785 | Freshwater Lake | MTKARDLANASTALGAVSATELAFVDGVTSAIQTQIDG |
Ga0181355_11866983 | 3300017785 | Freshwater Lake | MTKARDLANSAAAFASVSATELAFVDGVTSAIQTQMDAKAPSSTAVTLTGTQTLTN |
Ga0181355_12094892 | 3300017785 | Freshwater Lake | MTKARDLANASTALSAVSATELAFIDGATSNIQTQLDNVKPAD |
Ga0181359_10396091 | 3300019784 | Freshwater Lake | MSKARDLANAGTALGAVSATELAFVDGVTSAIQTQ |
Ga0181359_10488351 | 3300019784 | Freshwater Lake | MTKARDLASAIPAPSTVDATELGFLDGVTSAIQTS |
Ga0181359_10853773 | 3300019784 | Freshwater Lake | MTKARDLANSAAAFAAVSATELAFVDGVTSAIQTQIDAKAPSSTEVTLTGTQT |
Ga0181359_11342063 | 3300019784 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSSTAV |
Ga0181359_11631271 | 3300019784 | Freshwater Lake | MSKARDIASAIPAPSTVSSAELGFLDGVTSAIQTQIDTKQASSTA |
Ga0181359_11962481 | 3300019784 | Freshwater Lake | MTKARDLANASTALGAVSATELAFLDGVTSAVQTQIDGKQA |
Ga0181359_12595211 | 3300019784 | Freshwater Lake | MTKARDIASAIPAPSTVSSVELGYLDGVTSAIQTQIDAKIGS |
Ga0211734_106163953 | 3300020159 | Freshwater | MTKARDIASAIPAPSTVSSAELGYLDGVTSAIQTQLDAKTAKSTL |
Ga0181354_10598254 | 3300022190 | Freshwater Lake | MTKARDLANASTALSAVSATELAFVDGVTSAIQTQMDAKAPSSTAVT |
Ga0181351_10615971 | 3300022407 | Freshwater Lake | MTKARDIASAIPAPSTVDATELGFLDGVTSAIQTQIDAKTAKATLTTK |
Ga0181351_10708603 | 3300022407 | Freshwater Lake | MTKARDIASAIPAPSTVSSAELGFLDGVTSAIQTQLDAKTAKS |
Ga0214921_105050153 | 3300023174 | Freshwater | MDSGGTMTKARDLANGATALSAVSATELAYLDGVTSAVQTQIDGKQ |
Ga0214919_103144791 | 3300023184 | Freshwater | MTKARDLANSAAAFSAVSATELGYVDGVTSAIQTQLDAKAASST |
Ga0208160_10779151 | 3300025647 | Aqueous | MTKARDLANASTALSAVSATELGYLDGVTSAVQTQVDAKLATT |
Ga0255081_10638421 | 3300027155 | Freshwater | MTKARDLANASTALSAVSATELGYVDGVTSAIQTQMDA |
Ga0255097_10614862 | 3300027491 | Freshwater | MTKARDLANASTALSAVSATELGYVDGVTSAIQTQLDAKA |
Ga0209651_11958471 | 3300027581 | Freshwater Lake | MSKARDLANAGTALGAVSATELAFVDGVTSAIQTQLD |
Ga0209769_10659321 | 3300027679 | Freshwater Lake | MTKARDLANAGTALGAVSATELAFVDGVTSAIQTQIDA |
Ga0209442_12528281 | 3300027732 | Freshwater Lake | MTKARDLANAGTALGAVSATELAFVDGVTSAIQTQLDG |
Ga0209444_100358377 | 3300027756 | Freshwater Lake | VSKARDLAGAATALNAVTPTELGYLDGVTSAVQTQVDAKIAKSTVTTKG |
Ga0209296_100867713 | 3300027759 | Freshwater Lake | MSKARDLANAGTALTSVSATELGYVDGVTSAIQTQIN |
Ga0209246_100427354 | 3300027785 | Freshwater Lake | MTKARDLANAGTALGAVSATELAFVDGVTSAIQTQIDAKA |
Ga0209353_104668012 | 3300027798 | Freshwater Lake | MTKSRTLADAGTAFTSVSATELAFVDGVTSAIQTQIDGKQAVN |
Ga0209354_101670292 | 3300027808 | Freshwater Lake | MTKARDLANASTALSAVSATELAFIDGATSNIQTQLDNVKPADS |
Ga0209990_101259384 | 3300027816 | Freshwater Lake | MSKARDIASATPAPSTVSATELGYLDGVSSAIQTQIDSKI |
Ga0209400_10267601 | 3300027963 | Freshwater Lake | MTKARDLANSAAAFAAVSATELGYVDGVTSAIQTQMDAK |
Ga0209284_103505771 | 3300027983 | Freshwater | MTKARDIASAIPAPATVSSVELGYLDGVTSAIQTQVDSKI |
Ga0247723_11327621 | 3300028025 | Deep Subsurface Sediment | MSKARDLANAGTALTSVSATELGYLDGVTSAVQTQIDTKAASSTAV |
Ga0256305_11760592 | 3300028108 | Freshwater | MTKARDLANASTALSAVSATELGYLDGVTSAVQTQVDAKIAKTL |
Ga0119944_10175642 | 3300029930 | Aquatic | MTKARDIASAAPAPSTVSATEIGYLDGVSSAIQTQL |
Ga0315907_101709854 | 3300031758 | Freshwater | MTKARDIASASPAPSTVSATELGYLDGVSSAIQTQLDAKTAKSTL |
Ga0315907_102647724 | 3300031758 | Freshwater | MTKARDIASASPAPSTVSATELGYLDGVSSAIQTQVDGK |
Ga0315909_100503151 | 3300031857 | Freshwater | MSKARDLANAGTALTTVSATELGYLDGVTSAVQTQINTKA |
Ga0315909_103548121 | 3300031857 | Freshwater | MTKARDIASAAPAPSTVSATELGYLDGVSSAIQTQIDSKI |
Ga0315904_101792595 | 3300031951 | Freshwater | MTKARDLASAAPAPSTVSATELGYLDGVTSNIQTQIDSKTGGIATDTP |
Ga0315904_101902211 | 3300031951 | Freshwater | MSKARDIASATPAPSTVSSTELGYLDGVTSAIQTQINA |
Ga0315904_102215281 | 3300031951 | Freshwater | MTKARDIASATPAPSTVSATELGYLDGVSSAIQTQIDS |
Ga0315904_104355661 | 3300031951 | Freshwater | MSKARDLANAGTALTTVSATELGYLDGVTSAVQTQINAQI |
Ga0315906_105407521 | 3300032050 | Freshwater | MSKARDIASAAPAPSTVSATELGYVDGVTSAIQTQLDAKTAK |
Ga0315905_115373482 | 3300032092 | Freshwater | MTKARDLANAGTALGAVSATELAFVDGVTSAIQTQIDAK |
Ga0315903_102751362 | 3300032116 | Freshwater | MTKARDLANAGTGFTTVSATELGYLDGVTSAVQTQMDAQIPKSIVTTKGDL |
Ga0334982_0272511_1_114 | 3300033981 | Freshwater | MTRARDLASTALNSTVNTTELGYLDGVTSSVQTQLDAK |
Ga0334995_0135530_3_128 | 3300034062 | Freshwater | MTKARDIASAAPAPSTVSATELGYVDGVTSAIQTQLDAKTAK |
Ga0334995_0706602_2_118 | 3300034062 | Freshwater | MSKARDLANAGTALTTVSATELGYLDGVTSAVQTQIDSK |
Ga0335010_0288983_1_135 | 3300034092 | Freshwater | MTKSRDIASGIPAPSTVSSAELGYLDGVTSAIQTQIDTKLATATA |
Ga0335053_0234832_2_124 | 3300034118 | Freshwater | MTKARDIASAAPAPAGVTTTELGYVDGVTSALQTQIDSKIG |
Ga0335052_0096960_3_125 | 3300034279 | Freshwater | MSKARDLANAGTALTSVSATELGYLDGVTSAVQTQLDAKTA |
⦗Top⦘ |