Basic Information | |
---|---|
Family ID | F083228 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 39 residues |
Representative Sequence | INTHGDYAVANALCLLSLLVAAVGAAFYLRHAVARAERR |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.94 % |
% of genes near scaffold ends (potentially truncated) | 92.92 % |
% of genes from short scaffolds (< 2000 bps) | 88.50 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.947 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (7.080 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.938 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.053 % of family members) |
⦗Top⦘ |
Full Alignment |
---|
Alignment of all the sequences in the family. |
IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38.40.42.44.46.48. |
Powered by MSAViewer |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% |
Feature Viewer | |||||
Position : 0 Zoom : x 1 Enter the variants Position Original Variant |
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
⦗Top⦘ |
Visualization |
---|
All Organisms Unclassified |
Powered by ApexCharts |
⦗Top⦘ |
Visualization |
---|
Freshwater Sediment Wetland Freshwater Lake Sediment Sediment Wetland Sediment Freshwater Wetlands Freshwater Sediment Groundwater Polar Desert Sand Sediment Soil Sediment (Intertidal) Groundwater Sediment Watersheds Groundwater Sediment Soil Vadose Zone Soil Terrestrial Soil Glacier Forefield Soils Termite Nest Agricultural Soil Soil Grasslands Soil Hardwood Forest Soil Soil Soil Rice Paddy Soil Peatland Tropical Peatland Tropical Forest Soil Corn, Switchgrass And Miscanthus Rhizosphere Corn Rhizosphere Deep Subsurface Fen Peat Soil Sediment Corn Rhizosphere Switchgrass Rhizosphere Miscanthus Rhizosphere Switchgrass Rhizosphere Populus Rhizosphere Rhizosphere Corn Rhizosphere Miscanthus Rhizosphere Switchgrass Rhizosphere Miscanthus Rhizosphere Corn Rhizosphere Arabidopsis Rhizosphere Activated Sludge Anaerobic Digestor Sludge Sediment Slurry |
Powered by ApexCharts |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070658_102113731 | 3300005327 | Corn Rhizosphere | INTHGDYAVANALCLMSLVVAAIGAWFYLRQSTRALARQR* |
Ga0070683_1001181121 | 3300005329 | Corn Rhizosphere | AYRINTFSDYAVANALCLLSLLLAAFGAAFYLRHAVRSAAS* |
Ga0066388_1034000212 | 3300005332 | Tropical Forest Soil | THGDYAVANALCLLSLLLAAVGAVFYLRHAGGRTDAQAGR* |
Ga0068869_1009101811 | 3300005334 | Miscanthus Rhizosphere | NTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS* |
Ga0070660_1005972041 | 3300005339 | Corn Rhizosphere | INTHGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA* |
Ga0070661_1007911491 | 3300005344 | Corn Rhizosphere | YRINTFSDYAVANALCLLSLLLAAFGAAFYLRHAVRSAAS* |
Ga0070667_1019978951 | 3300005367 | Switchgrass Rhizosphere | INTHGDYAVANALCLLSLLVAAVGAAFYLRHAVARAERR* |
Ga0068867_1013066941 | 3300005459 | Miscanthus Rhizosphere | YRINTHGDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA* |
Ga0070679_1006607832 | 3300005530 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLVAAFGAAFYLRHAVRRAESGA* |
Ga0068853_1011355841 | 3300005539 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLLAAAGAALYLRHAVKRAA* |
Ga0068853_1022479971 | 3300005539 | Corn Rhizosphere | RINTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS* |
Ga0066697_100667184 | 3300005540 | Soil | YPVANALCLLSLALAAIGAVFYLRHAAGQVEEHRR* |
Ga0066695_108648981 | 3300005553 | Soil | DVAYRISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVERT* |
Ga0068855_1000579221 | 3300005563 | Corn Rhizosphere | DYGVANALCLMSLVIAAVGAWFYLRHSLRNAEAVT* |
Ga0068857_1014305002 | 3300005577 | Corn Rhizosphere | VDVAYRINTFADYAVANALCLLSLLLAAAGAALYLRHAVKRAA* |
Ga0068854_1008503552 | 3300005578 | Corn Rhizosphere | DYAVANALCLLSLLLAAFGAAFYLRHAVHRAENT* |
Ga0070702_1016146381 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VAYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVKGAEAAS* |
Ga0074472_111014652 | 3300005833 | Sediment (Intertidal) | THGDYAVANALCLVSLLFASLGAWVYLRHAVAKAEQGS* |
Ga0074472_112430511 | 3300005833 | Sediment (Intertidal) | HGDYAVANALCLVSLLFASLGAWIYLRHAVAKAEQGA* |
Ga0068863_1002396444 | 3300005841 | Switchgrass Rhizosphere | STLSDYAVANALCLLSLIVAAGGAWFYLRHASESVK* |
Ga0075278_10402791 | 3300005893 | Rice Paddy Soil | TFADYAVANALCLLSLLLAAVGAAFYLRHAVHRAEGPQ* |
Ga0075023_1004476221 | 3300006041 | Watersheds | HGDYAVANALCLVSLAFASLGAWVYLRHAVQQVART* |
Ga0075024_1007075412 | 3300006047 | Watersheds | HGDYAVANALCLISLLFASLGAWVYLRHAVKRVGGA* |
Ga0082029_10064343 | 3300006169 | Termite Nest | YRISTLSDYAVANALCLMSLVVAAGGAWFYLRHAVARAEGT* |
Ga0079037_1001802861 | 3300006224 | Freshwater Wetlands | VAYRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA* |
Ga0079221_106273152 | 3300006804 | Agricultural Soil | TFADYPVANALCLMSLVLAGGGAWFYLRHAAQKVEAAA* |
Ga0079303_100940091 | 3300006930 | Deep Subsurface | AYRISTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA* |
Ga0079219_122611561 | 3300006954 | Agricultural Soil | STHADYPVANALCLLSLALAAIGAVFYLRHAVAKAEGA* |
Ga0075435_1019950012 | 3300007076 | Populus Rhizosphere | RINTHADYAVANALCLMSLVIAAFGAWFYLRHAARRVT* |
Ga0075418_106997493 | 3300009100 | Populus Rhizosphere | TFADYAVANALCLLTLLLAAFGAAFYLRHAVRRAESTS* |
Ga0105100_102294871 | 3300009166 | Freshwater Sediment | NTHGDYGVANALCLASLLLAAGGAWFYLRHAVVRAEAAA* |
Ga0113563_121374712 | 3300009167 | Freshwater Wetlands | AEYAVANALCLLSLLVAAGGAAFYLRHAVKSAGEAA* |
Ga0115028_105956971 | 3300009179 | Wetland | RISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA* |
Ga0114942_13165742 | 3300009527 | Groundwater | INDHGDYAVANALCLMSLLIAAAAAWIYLRHATARHTAAS* |
Ga0131092_111120091 | 3300009870 | Activated Sludge | YRISTMGDYAVANALCLMSLVVAAGAAWFYLQHSAKAMRQ* |
Ga0116249_102530791 | 3300010357 | Anaerobic Digestor Sludge | HGDYAVANALCLVSLLFGAAGAWVYLRHAVRRAEQVS* |
Ga0134121_108209992 | 3300010401 | Terrestrial Soil | YRINTHSDYAVANALCLLSLLVAAGGAAFYLRHAVKGAETKS* |
Ga0137776_12060432 | 3300010937 | Sediment | AYRIATFGDYPVANALCLLTLGRAAIGAVFYLRHAGAGAAKT* |
Ga0137437_11448311 | 3300011442 | Soil | SDYAVANALCLLSLLVAATAAWLYLRHAVGQVARQ* |
Ga0136620_101871662 | 3300012186 | Polar Desert Sand | GDYAVANALCLMSLLVAAAGAWFYLRQVSGQVRQR* |
Ga0137363_111753682 | 3300012202 | Vadose Zone Soil | DYPVANALCLLSLGLAAIGAVFYLRHATARAVGS* |
Ga0137372_100511684 | 3300012350 | Vadose Zone Soil | VAYRINTHADYAVANALCLMSLLVAAIGAAFYLRHATRQSSA* |
Ga0137386_101670131 | 3300012351 | Vadose Zone Soil | INTHADYAVANALCLLSLLVAAIGAAFYLRHASAKVSQT* |
Ga0137386_108771732 | 3300012351 | Vadose Zone Soil | VAYRISTHGDYPVANALCLLSLALAAIGAVFYLRHAAAQVEGK* |
Ga0137385_110926741 | 3300012359 | Vadose Zone Soil | YRINTFADYAVANALCLLSLILAAGGAWFYLQHAVGKVEKT* |
Ga0157297_100211471 | 3300012914 | Soil | DYAVANALCLLTLLFAAFGAAFYLRHAVRRAEATS* |
Ga0164299_110344302 | 3300012958 | Soil | AYWINTHSDYAVANALCLLSLIVAAGGAAFYLRHAVKSAEGKA* |
Ga0157378_108488201 | 3300013297 | Miscanthus Rhizosphere | DYAVANALCLMSLVVAAIGAWFYLRQSTRALARQR* |
Ga0157372_105267783 | 3300013307 | Corn Rhizosphere | AYRINTHADYAVANALCLLSLLLAAVGAAFYLRHAVKRVESGG* |
Ga0157375_116022262 | 3300013308 | Miscanthus Rhizosphere | STLSDYGVANALCLISLVVAAGAAWFYLQHAADKVRR* |
Ga0157375_128227971 | 3300013308 | Miscanthus Rhizosphere | INTFADYAVANALCLLSLLLAAVGAAFYLRHAVKRVETGS* |
Ga0163163_115148142 | 3300014325 | Switchgrass Rhizosphere | DYAVANALCLLSLLVAAGGAWFYLRHAVKGAEDKT* |
Ga0167636_10334032 | 3300015075 | Glacier Forefield Soils | NTFGDYAVANALCLLSLVLAAGGAWFYLHHAVEKVTRA* |
Ga0132256_1019296741 | 3300015372 | Arabidopsis Rhizosphere | AYRISTLSDYAVANALCLMCLIVAAAAAWFYLKHAAAERSRA* |
Ga0132256_1037444111 | 3300015372 | Arabidopsis Rhizosphere | DVAYRISTHGDYPVANALCLLTLGLSAIGAAFYLRHASRSSRAATS* |
Ga0187821_101265972 | 3300017936 | Freshwater Sediment | YRIATHGDYPVANALCLLSLALAAIGAVFYLRHAVAKAEGA |
Ga0184604_100905272 | 3300018000 | Groundwater Sediment | HADYAVANALCLLSLLVAALGAAFYLRHAVRRSDA |
Ga0187765_100620431 | 3300018060 | Tropical Peatland | STHADYPVANALCLLTLVLAAIGAVFYLRHAGVRAEGEASR |
Ga0184609_102299732 | 3300018076 | Groundwater Sediment | ISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVRGT |
Ga0184629_105071142 | 3300018084 | Groundwater Sediment | DIAYRISTLGDYSVANALCLMSLIVAAGAAWFYLQHTAKKI |
Ga0066667_108750052 | 3300018433 | Grasslands Soil | VAYRIKTFSDSAVAYAICLMSLALAAGGTWFYLRHAAARVDAR |
Ga0190273_109111081 | 3300018920 | Soil | HGDYAVANALCLMSLVLASAGAWFYLREAARKAERA |
Ga0212091_103833041 | 3300022549 | Groundwater | SDYAVANALCLMSLLIAAAAAWIYLRHATARHTAAS |
Ga0222623_103441051 | 3300022694 | Groundwater Sediment | YRISTHADYPVANALCLLSLALAAIGAVFYLRHAAAQVRGT |
Ga0207699_100634804 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AYRISTFADYAVANALCLLSLLLAAFGAAFYLRHAVQRVEVKG |
Ga0207705_107623972 | 3300025909 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLLAAVGAAFYLRHAVKRVETGS |
Ga0207684_116270662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FADYPVANALCLLSLVLAAGGAWFYLRHASKKIEVVA |
Ga0207707_109494311 | 3300025912 | Corn Rhizosphere | ISTFADYAVANALCLLSLLLAAFGAAFYLRHAVRKVEGA |
Ga0207657_105130052 | 3300025919 | Corn Rhizosphere | GDYGVANALCLMSLVIAAVGAWFYLRHSLRNAEAVT |
Ga0207649_108653351 | 3300025920 | Corn Rhizosphere | GDYAVANALCLVSLLLAAVGAAFYLKHSVGQAERRA |
Ga0207652_105964482 | 3300025921 | Corn Rhizosphere | YRINTFADYAVANALCLLSLLVAAFGAAFYLRHAVRRAESGA |
Ga0207659_106768852 | 3300025926 | Miscanthus Rhizosphere | INTHSDYAVANALCLLSLLVAAGGAWFYLRHAVKGAEDKT |
Ga0207690_113694932 | 3300025932 | Corn Rhizosphere | INTFADYAVANALCLLTLLFAAFGAAFYLRHAVRRAEATS |
Ga0207679_116484011 | 3300025945 | Corn Rhizosphere | TFADYAVANTLCLLTLLFAAFGAAFYLRHAVRRAEATS |
Ga0207668_115168631 | 3300025972 | Switchgrass Rhizosphere | YRISTLSDYAVANALCLISLVVAAGAAWFYLQHAAREQARA |
Ga0207658_113117652 | 3300025986 | Switchgrass Rhizosphere | AYRINTHSDYAVANALCLLSLIVAAGGAAFYLRHAVKSAAATT |
Ga0207676_115816471 | 3300026095 | Switchgrass Rhizosphere | MSLLRTGAIYGVANALCLLSLLVAAGGAAFYLRHAVKGAEAAS |
Ga0209156_101696092 | 3300026547 | Soil | VAYRISTLSDYAVANALCLLTLIVAAGGAWFYLRHAAAEGGRA |
Ga0209798_102219861 | 3300027843 | Wetland Sediment | VAYRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVKSAGAAS |
Ga0209254_103927571 | 3300027897 | Freshwater Lake Sediment | AYRISTLSDYAVANALCLMSLVVAAAGAWFYLQHAKARQL |
Ga0209668_107554851 | 3300027899 | Freshwater Lake Sediment | GDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA |
Ga0209253_104801011 | 3300027900 | Freshwater Lake Sediment | SDYAVANALCLLSLLVAGGGAAFYLRHAVRSAGGTQ |
Ga0307504_101037711 | 3300028792 | Soil | YRISTHGDYPVANALCLLSLALAAIGAVFYLRHAAAQVEGK |
Ga0307503_103775202 | 3300028802 | Soil | SDYAVANALCLMSLLVAAAAAWMYLRHAVAQVART |
Ga0302298_100920752 | 3300029980 | Fen | HGDYPVANALCILSLALSGIGAAFYLRHASRTSTAAT |
Ga0311350_115699741 | 3300030002 | Fen | ISTHGDYPVANALCLLTLGLSAIGAAFYLRHASRSSRAATS |
Ga0310887_104511162 | 3300031547 | Soil | HGDYAVANALCLMSLVVAAFGAWFYLRQSSRALAK |
Ga0302321_1012801452 | 3300031726 | Fen | YRINTHGDYPVANALCILSLALSAIGAAFYLRHASRTSTAAT |
Ga0307473_102942582 | 3300031820 | Hardwood Forest Soil | STHGDYPVANALCLLTLVLAAIGAVFYLRHAGASAEKR |
Ga0308174_102327372 | 3300031939 | Soil | DVAYRINTFADYAVANALCLLSLLLAAVGAAFYLSHAVKRVEAG |
Ga0308174_111185682 | 3300031939 | Soil | ISTFADYAVANALCLLSLLLAAFGAAFYLRHAVRKVESA |
Ga0315294_106712711 | 3300031952 | Sediment | YRINTHADYAVANALCLLSLLVAAGGAAFYLRHAVRSAGATS |
Ga0307409_1027228182 | 3300031995 | Rhizosphere | HGDYAVANALCLVSLLFASLGAAIYLRHAVRRAELAP |
Ga0307411_107051092 | 3300032005 | Rhizosphere | DVAYRINTFADYAVANALCLLTLLLAAFGAAFYLRHAVRRAESTS |
Ga0310906_100373131 | 3300032013 | Soil | VAYRISTLSDYAVANALCLMSLVVAAGGAWFYLQHSAKTIK |
Ga0315284_111928782 | 3300032053 | Sediment | DYAVANALCLLSLLVAAGGAAFYLRHAVRSAGATS |
Ga0308173_101996803 | 3300032074 | Soil | ADYAVANALCLLSLLLAAFGAAFYLRHAVRRVEAP |
Ga0307470_117928321 | 3300032174 | Hardwood Forest Soil | TLSDYAVANALCLMCLVVAAGAAWFYLQHAAAERSRT |
Ga0307471_1034734602 | 3300032180 | Hardwood Forest Soil | TVDVAYRINTHGDYAVANALCLMSLLLAAVGAAFYLRQAGRKADS |
Ga0307472_1008755532 | 3300032205 | Hardwood Forest Soil | YRISTHGDYPVANALCLLSLLLAAIGAVFYLRHAAAGAERS |
Ga0307472_1013338201 | 3300032205 | Hardwood Forest Soil | DYAVANALCLISLVVAAGGAAFYLRHAVKSAEGTG |
Ga0307472_1016067212 | 3300032205 | Hardwood Forest Soil | FGDYAVANALCLLSLILAAGGAWFYLHHAVEKVERA |
Ga0316605_105736871 | 3300033408 | Soil | AYRISTLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA |
Ga0316619_119631151 | 3300033414 | Soil | RISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA |
Ga0316622_1011241742 | 3300033416 | Soil | INTHSDYGVANALCLASLALAAAGAWFYLRHAVARVEVAS |
Ga0316601_1003250141 | 3300033419 | Soil | TLSDYAVANALCLMSLAVAAVGAWFYLQHAKRQTLSA |
Ga0326726_110583201 | 3300033433 | Peat Soil | GDYAVANALCLMSLVLASFGAWFYLREAAAKKADRT |
Ga0316620_108946812 | 3300033480 | Soil | VAYRISTHGDYAVANALCLVSLVFASLGAWVYLHHAVKRVGVA |
Ga0316627_1019370301 | 3300033482 | Soil | SDYAVANALCLLSLLVAAGGAWFYLRHAARGARGEAVQ |
Ga0314863_045725_1_117 | 3300033804 | Peatland | STHGDYAVANALCLLSLALAAIGAVFYLRHASARAEGG |
Ga0373894_026969_710_823 | 3300034074 | Sediment Slurry | HADYGVANALCLASLVLAAAGAWFYLRHAVERAEDSG |
Ga0364929_0255889_479_589 | 3300034149 | Sediment | HSDYAVANALCLMSLLVAAAAAWLYLRHAVRQHARQ |
Ga0364923_0138952_515_628 | 3300034690 | Sediment | HSDYGVANALCLASLALAAAGAWFYLHHAVAKAESST |
⦗Top⦘ |