Basic Information | |
---|---|
Family ID | F083146 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 43 residues |
Representative Sequence | MQAGDYLNTALVFSGIIMIAILGLVLDACLRGLLLLADPSRRR |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.42 % |
% of genes near scaffold ends (potentially truncated) | 80.53 % |
% of genes from short scaffolds (< 2000 bps) | 89.38 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.416 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (12.389 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.239 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.558 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF09130 | DUF1932 | 13.27 |
PF02566 | OsmC | 7.96 |
PF00581 | Rhodanese | 4.42 |
PF00390 | malic | 2.65 |
PF00496 | SBP_bac_5 | 2.65 |
PF09664 | DUF2399 | 2.65 |
PF13304 | AAA_21 | 1.77 |
PF00561 | Abhydrolase_1 | 1.77 |
PF05544 | Pro_racemase | 1.77 |
PF00753 | Lactamase_B | 1.77 |
PF01553 | Acyltransferase | 1.77 |
PF00296 | Bac_luciferase | 1.77 |
PF04951 | Peptidase_M55 | 1.77 |
PF12706 | Lactamase_B_2 | 1.77 |
PF00005 | ABC_tran | 1.77 |
PF02668 | TauD | 1.77 |
PF03640 | Lipoprotein_15 | 1.77 |
PF02366 | PMT | 1.77 |
PF02771 | Acyl-CoA_dh_N | 1.77 |
PF04199 | Cyclase | 1.77 |
PF00106 | adh_short | 1.77 |
PF02517 | Rce1-like | 0.88 |
PF07702 | UTRA | 0.88 |
PF09348 | DUF1990 | 0.88 |
PF13380 | CoA_binding_2 | 0.88 |
PF01613 | Flavin_Reduct | 0.88 |
PF00202 | Aminotran_3 | 0.88 |
PF12697 | Abhydrolase_6 | 0.88 |
PF13777 | Obsolete Pfam Family | 0.88 |
PF04185 | Phosphoesterase | 0.88 |
PF13419 | HAD_2 | 0.88 |
PF01654 | Cyt_bd_oxida_I | 0.88 |
PF07077 | DUF1345 | 0.88 |
PF02452 | PemK_toxin | 0.88 |
PF05726 | Pirin_C | 0.88 |
PF00722 | Glyco_hydro_16 | 0.88 |
PF01593 | Amino_oxidase | 0.88 |
PF01738 | DLH | 0.88 |
PF13298 | LigD_N | 0.88 |
PF04138 | GtrA | 0.88 |
PF05995 | CDO_I | 0.88 |
PF13191 | AAA_16 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 13.27 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 7.96 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 7.96 |
COG0281 | Malic enzyme | Energy production and conversion [C] | 2.65 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.77 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.77 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.77 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.77 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.77 |
COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 1.77 |
COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.88 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.88 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.88 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.88 |
COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.88 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.88 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.88 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.88 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.42 % |
Unclassified | root | N/A | 18.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY02F8IM5 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
2170459010|GIO7OMY02IHQRE | Not Available | 500 | Open in IMG/M |
3300005434|Ga0070709_10179517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1485 | Open in IMG/M |
3300005434|Ga0070709_10609226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
3300005437|Ga0070710_10576019 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005439|Ga0070711_101930401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
3300005445|Ga0070708_100661007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
3300005468|Ga0070707_100675077 | Not Available | 996 | Open in IMG/M |
3300005471|Ga0070698_100026818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5992 | Open in IMG/M |
3300005536|Ga0070697_100390280 | Not Available | 1207 | Open in IMG/M |
3300005563|Ga0068855_102440671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300005614|Ga0068856_101670303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300005921|Ga0070766_10665248 | Not Available | 703 | Open in IMG/M |
3300005921|Ga0070766_10886545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
3300005995|Ga0066790_10092562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1299 | Open in IMG/M |
3300005995|Ga0066790_10173696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
3300006028|Ga0070717_10325074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1371 | Open in IMG/M |
3300006050|Ga0075028_101074248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300006173|Ga0070716_100589141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
3300006755|Ga0079222_10440518 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300006804|Ga0079221_10052584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1833 | Open in IMG/M |
3300009520|Ga0116214_1440466 | Not Available | 510 | Open in IMG/M |
3300009522|Ga0116218_1007013 | All Organisms → cellular organisms → Bacteria | 5155 | Open in IMG/M |
3300009545|Ga0105237_10273484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1692 | Open in IMG/M |
3300009631|Ga0116115_1193501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300009764|Ga0116134_1001425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12120 | Open in IMG/M |
3300010048|Ga0126373_10125490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2407 | Open in IMG/M |
3300010358|Ga0126370_11786518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300010366|Ga0126379_10102020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2555 | Open in IMG/M |
3300010371|Ga0134125_12015308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300010373|Ga0134128_12399631 | Not Available | 581 | Open in IMG/M |
3300010375|Ga0105239_10745023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
3300010376|Ga0126381_104001736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 574 | Open in IMG/M |
3300010379|Ga0136449_101206671 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300010379|Ga0136449_102686642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 707 | Open in IMG/M |
3300010379|Ga0136449_102732819 | Not Available | 699 | Open in IMG/M |
3300010397|Ga0134124_10419767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1277 | Open in IMG/M |
3300010398|Ga0126383_10779026 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300011106|Ga0151489_1550777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
3300012198|Ga0137364_10272857 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300012210|Ga0137378_11032125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300012351|Ga0137386_10682781 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300012929|Ga0137404_10681418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
3300012958|Ga0164299_11513117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
3300012971|Ga0126369_11315709 | Not Available | 813 | Open in IMG/M |
3300012977|Ga0134087_10777002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300013308|Ga0157375_11211029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
3300014162|Ga0181538_10675174 | Not Available | 536 | Open in IMG/M |
3300014491|Ga0182014_10006620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12381 | Open in IMG/M |
3300014491|Ga0182014_10435060 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300014501|Ga0182024_11179997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 897 | Open in IMG/M |
3300015264|Ga0137403_10609710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
3300017926|Ga0187807_1014009 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
3300017926|Ga0187807_1021804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso899 | 1975 | Open in IMG/M |
3300017926|Ga0187807_1137816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 777 | Open in IMG/M |
3300017948|Ga0187847_10743427 | Not Available | 553 | Open in IMG/M |
3300017948|Ga0187847_10906645 | Not Available | 502 | Open in IMG/M |
3300017966|Ga0187776_11359176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 539 | Open in IMG/M |
3300017970|Ga0187783_10798537 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300017972|Ga0187781_11338592 | Not Available | 529 | Open in IMG/M |
3300017995|Ga0187816_10327828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
3300018006|Ga0187804_10168299 | Not Available | 928 | Open in IMG/M |
3300018030|Ga0187869_10135169 | Not Available | 1229 | Open in IMG/M |
3300018033|Ga0187867_10506047 | Not Available | 664 | Open in IMG/M |
3300018034|Ga0187863_10196354 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300018037|Ga0187883_10561783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300018060|Ga0187765_10105659 | Not Available | 1540 | Open in IMG/M |
3300018060|Ga0187765_10259027 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300018086|Ga0187769_10556327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
3300019082|Ga0187852_1320695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
3300020062|Ga0193724_1120144 | Not Available | 520 | Open in IMG/M |
3300020582|Ga0210395_10750164 | Not Available | 729 | Open in IMG/M |
3300021374|Ga0213881_10436322 | Not Available | 591 | Open in IMG/M |
3300021377|Ga0213874_10086367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
3300021402|Ga0210385_10602313 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300021405|Ga0210387_10756301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
3300021474|Ga0210390_10300703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1359 | Open in IMG/M |
3300025627|Ga0208220_1132327 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300025900|Ga0207710_10283188 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300025914|Ga0207671_10659839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
3300025915|Ga0207693_10310825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
3300025915|Ga0207693_10617006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300025916|Ga0207663_11233512 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300025923|Ga0207681_11487659 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300025928|Ga0207700_10389408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → Candidatus Dormibacter → unclassified Candidatus Dormibacter → Candidatus Dormibacter sp. RRmetagenome_bin12 | 1220 | Open in IMG/M |
3300026294|Ga0209839_10112331 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300026548|Ga0209161_10276922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300026555|Ga0179593_1055044 | Not Available | 3496 | Open in IMG/M |
3300027058|Ga0209111_1033563 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300027096|Ga0208099_1007803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium canum | 1370 | Open in IMG/M |
3300027696|Ga0208696_1170859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
3300027783|Ga0209448_10257948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 574 | Open in IMG/M |
3300027853|Ga0209274_10279229 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300027879|Ga0209169_10484568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
3300027895|Ga0209624_10443860 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300028562|Ga0302151_10133267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 861 | Open in IMG/M |
3300028562|Ga0302151_10228762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300028906|Ga0308309_10224973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1558 | Open in IMG/M |
3300030494|Ga0310037_10135901 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300030707|Ga0310038_10271577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. NBS 14/10 | 776 | Open in IMG/M |
3300031713|Ga0318496_10082886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1703 | Open in IMG/M |
3300032160|Ga0311301_10081264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6638 | Open in IMG/M |
3300032160|Ga0311301_11073277 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300032160|Ga0311301_11425313 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300032770|Ga0335085_10128405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3221 | Open in IMG/M |
3300032770|Ga0335085_11365485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
3300032783|Ga0335079_10381377 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300032895|Ga0335074_10108656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Terrybacteria → Candidatus Terrybacteria bacterium RIFCSPHIGHO2_01_FULL_58_15 | 3630 | Open in IMG/M |
3300032898|Ga0335072_10106086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3573 | Open in IMG/M |
3300032898|Ga0335072_11241656 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300033134|Ga0335073_10372477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1682 | Open in IMG/M |
3300033134|Ga0335073_11031518 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300033546|Ga0316213_1015131 | Not Available | 549 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.39% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.08% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.31% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.65% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.65% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.65% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.65% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.77% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.77% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.77% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.89% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.89% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.89% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.89% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_03018860 | 2170459010 | Grass Soil | NTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR |
F62_08196720 | 2170459010 | Grass Soil | MIMQAGDYLNTALVFAGIITIALAGLILDGCLRGLLILADPSRRR |
Ga0070709_101795173 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DYLNTALVFAGIITIAIAGLVLDTGLRGLLMLADPSRRR* |
Ga0070709_106092262 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LIMQAGDYLNTALVFSGIITIAILGLILDALLRGLLLLADPSRRR* |
Ga0070710_105760192 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GDYLNTALVFSGIIMIAILGLALDACLRGLLLLADPSRRR* |
Ga0070711_1019304012 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LIMQAGDYLNTALVFAGIITIAIAGLVLDIGLRGLLILADPSRRR* |
Ga0070708_1006610072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGDYPDTALAFAGILTIAVTALILDAALGLLLLAEPGRRG* |
Ga0070707_1006750771 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGDYPDTALAFAGSLTIVVTALILDAALRGLLLLAGPGRSG* |
Ga0070698_1000268185 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGDYPDTALAFAGTLTIVVTALILDAALRGLLLLAGPGRSG* |
Ga0070697_1003902801 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGDYPDTALAFAGSLTIVVTALILDAALRLLLLADPGRRG* |
Ga0068855_1024406711 | 3300005563 | Corn Rhizosphere | SQAGNYLDTALVFACIILIAVTELTIDAGLRVLASRVDPSRLASRVG* |
Ga0068856_1016703031 | 3300005614 | Corn Rhizosphere | MQAGDYLNTALVFSGIITIAILGLILDACLRGLLLLADPSRRR* |
Ga0070766_106652482 | 3300005921 | Soil | TNGVGYLIMQAGDYLNVALVFSGIITIAIMGLALDAGLRGMLYLADPSKRG* |
Ga0070766_108865451 | 3300005921 | Soil | LGYLIQQAGDYLNTALVLSGIICIAVIALTLDAGLRGLLLLADPSRRG* |
Ga0066790_100925623 | 3300005995 | Soil | LGFVIMQAGDYLDTALVFAGIITIAIAGLALDAGLRGLLLLADPSRRG* |
Ga0066790_101736961 | 3300005995 | Soil | QAGDYLNTSLVFAGVITIAIAGLVLDACLRGLLLFVDPSRRS* |
Ga0070717_103250742 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MQSGDYPDTALAFAGSLTIAVTALILDAALRLLLLAEPGRRG* |
Ga0075028_1010742482 | 3300006050 | Watersheds | NTALVFSGIIMIAILGLVLDACLRGLLLLADPSRRR* |
Ga0070716_1005891412 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TALVFAGIITIALAGLILDGCLRGLLILADPSRRR* |
Ga0079222_104405183 | 3300006755 | Agricultural Soil | DYLNTALVFSGIIMIAILGLALDACLRGLLLLADPSRRR* |
Ga0079221_100525844 | 3300006804 | Agricultural Soil | MQAGDYLNTALVFSGIIMIAILGLILDACLRGLLLLADPSRRR* |
Ga0116214_14404661 | 3300009520 | Peatlands Soil | ALVFSGLICIALIALTLDACIRGLLLLTDPSRRT* |
Ga0116218_10070131 | 3300009522 | Peatlands Soil | NIALVFSGLICIALIALTLDACIRGLLLLTDPSRRT* |
Ga0105237_102734841 | 3300009545 | Corn Rhizosphere | LIMQAGDYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR* |
Ga0116115_11935012 | 3300009631 | Peatland | GYLIMQAGDYLNTALTLSGIIAIAILGLTLDICLRGLLSLVDPSRRR* |
Ga0116134_10014256 | 3300009764 | Peatland | VLRRERALISQADDYLNTSLVFAGIITIAIAGLVLDACLRGLLLWVDPSRRS* |
Ga0126373_101254904 | 3300010048 | Tropical Forest Soil | NTALVFAGIITIAGAGLVLDACLRLLLVLADPSRRR* |
Ga0126370_117865182 | 3300010358 | Tropical Forest Soil | MQAGDYLNTALVFSGIIAIAILGLVLDACLRGLLLLADPSRRR* |
Ga0126379_101020204 | 3300010366 | Tropical Forest Soil | MIMQAGDYLNTALVFAGIITVAVAGLILDCCLRGLLILADPSRRR* |
Ga0134125_120153081 | 3300010371 | Terrestrial Soil | QAGDYLNTALVFSGIIMIAIIALVLDACLRGLLLVADPSRRRRQG* |
Ga0134128_123996313 | 3300010373 | Terrestrial Soil | DYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR* |
Ga0105239_107450231 | 3300010375 | Corn Rhizosphere | LNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR* |
Ga0126381_1040017362 | 3300010376 | Tropical Forest Soil | GLGYVIMQAGDYLNTALVFAGIITIAGAGLVLDACLRLLLVLADPSRRR* |
Ga0136449_1012066712 | 3300010379 | Peatlands Soil | MQAGDYLDTTLVFAGIITIAITGLALDAGLRGLLILANPSRRG* |
Ga0136449_1026866421 | 3300010379 | Peatlands Soil | AATNGLGYLIMQASDYLNTALVFSGIIAIAIVGLILDACLRGLLLLADPSRRR* |
Ga0136449_1027328192 | 3300010379 | Peatlands Soil | MQAGDYLNTSLAFSGILMIAILSLALDACIRGLLLIADPSRRS* |
Ga0134124_104197673 | 3300010397 | Terrestrial Soil | ALVFAGIITIAIAGLVLDTGLRGLLMLADPSRRR* |
Ga0126383_107790261 | 3300010398 | Tropical Forest Soil | PLVFAGIITIAVAGLILDCCLRGLLILADPSRRR* |
Ga0151489_15507772 | 3300011106 | Soil | PACAGSLQAGDYMNTALVFSGIITIAILGLVLDACLRGLLLLADPSRRR* |
Ga0137364_102728572 | 3300012198 | Vadose Zone Soil | YLIMQAGDYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR* |
Ga0137378_110321252 | 3300012210 | Vadose Zone Soil | AGDYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR* |
Ga0137386_106827811 | 3300012351 | Vadose Zone Soil | GYMIMQAGDYLDTALAFAGIITIAIIALVIDAGLRGLLLLADPGRRG* |
Ga0137404_106814182 | 3300012929 | Vadose Zone Soil | IMQAGDYLNTALVFSGIIMIAILGLALDACLRGLLLLADPSRRR* |
Ga0164299_115131171 | 3300012958 | Soil | TALVFSGIITIAILGLALDACLRGLLLLADPSRRR* |
Ga0126369_113157092 | 3300012971 | Tropical Forest Soil | FMIMQAGDYLNTALVFAGIITIAVAGLILDCCLRGLLILADPSRRR* |
Ga0134087_107770022 | 3300012977 | Grasslands Soil | GLGYLIMQAGDYLNTALVFSGIISIAILGLGLDACLRGLLLLADPSRRR* |
Ga0157375_112110291 | 3300013308 | Miscanthus Rhizosphere | TALVFSGIIMIAIIALVLDACLRGLLLLADQSRRR* |
Ga0181538_106751741 | 3300014162 | Bog | QAGDYLNIALVFSGLICIALIALALDACIRGLLLLTDPSRRT* |
Ga0182014_100066202 | 3300014491 | Bog | VLRRERALISQAGDYLNTSLVFAGIITIAFAGLVLDACLRSLLLLVDPSRRS* |
Ga0182014_104350602 | 3300014491 | Bog | LGYLIQQAGDYLNTALVFSGIIAIAILGLTLDFSLRGLLVTVDPSRRQ* |
Ga0182024_111799971 | 3300014501 | Permafrost | LISQAGDYLNTSLVFAGIITIAIAGLVLDACLRGLLLFVDPSRRS* |
Ga0137403_106097101 | 3300015264 | Vadose Zone Soil | GYLIMQAGDYLNTALVFSGIISIAILGLALDACLRGLLLLADPSRRR* |
Ga0187807_10140092 | 3300017926 | Freshwater Sediment | MQAGDYLNTALVFSGIIAIAILGLTLDACLRALLLLADPSRRR |
Ga0187807_10218041 | 3300017926 | Freshwater Sediment | TTGLGYLIMQAGDYLNTALVFSGIIAIAILGLILDASLRALLLLADPSRRR |
Ga0187807_11378161 | 3300017926 | Freshwater Sediment | AGDYLNTALVFSGIIAIAILGLTLDACLRALLLLADPSRRR |
Ga0187847_107434271 | 3300017948 | Peatland | YLNTALVFSGIISIAILGLTLDACLRGLLLLADPSRRR |
Ga0187847_109066452 | 3300017948 | Peatland | LTKAGLFAMLGNYLNTALVFSGIISIAILGLTLDACLRGLLLLADPSRRR |
Ga0187776_113591761 | 3300017966 | Tropical Peatland | MQAGDYLNTALVFAGIITIAVTGLILDTCLRALLVLADPSRRR |
Ga0187783_107985371 | 3300017970 | Tropical Peatland | AGDYLDTALVFAGIIMIAVAGLTLDACLRWLLVLADPSRRR |
Ga0187781_113385922 | 3300017972 | Tropical Peatland | NTALVFSGIIAIAILGLALDVCLRGLLLIVDPSRRR |
Ga0187816_103278282 | 3300017995 | Freshwater Sediment | ATTGLGYLIMQAGDYLNTALVFSGIIAIAILGLALDACLRVLLLLADPSRRR |
Ga0187804_101682991 | 3300018006 | Freshwater Sediment | TALVFSGIIAIAILGLTLDACLRGLLLLADPSRRR |
Ga0187869_101351691 | 3300018030 | Peatland | VLRRERALISQADDYLNTSLVFAGIITIAIAGLVLDACLRGLLLWVDPSRRS |
Ga0187867_105060471 | 3300018033 | Peatland | AGNYLRTSLVFCGIISIGIMGLLLDACLRLLLRWADPARR |
Ga0187863_101963543 | 3300018034 | Peatland | LNTALVFSGIISIAILGLTLDACLRGLLLLADPSRRR |
Ga0187883_105617831 | 3300018037 | Peatland | LGYLIMQAGDYLNTALVFSGIISIAILGLVLDACLRGLLLLADPSRRR |
Ga0187765_101056593 | 3300018060 | Tropical Peatland | DYLNTALVLSGIICIAVIALALDACLRGLLLLADPSRRG |
Ga0187765_102590272 | 3300018060 | Tropical Peatland | YLNTALVFAGIITIALAGLILDGCLRGLLILADPSRRR |
Ga0187769_105563271 | 3300018086 | Tropical Peatland | YLDTSLVFAGIIMIAVAGLTLDACLRWLLVLADPSRRR |
Ga0187852_13206951 | 3300019082 | Peatland | DYLNTALVLSGIICIALIALVLDACIRGLLLLADPSRRG |
Ga0193724_11201441 | 3300020062 | Soil | MQAGDYLDTALVFAGIITIAIAGLVLDAGLRGLLLLADPSRRG |
Ga0210395_107501642 | 3300020582 | Soil | NTALVFSGIIAIAILGLTLDACLRGLLLLADPSRRR |
Ga0213881_104363221 | 3300021374 | Exposed Rock | NMSIVFAGIITIAVAGLLLDACLRGLLLVADPSRRS |
Ga0213874_100863672 | 3300021377 | Plant Roots | MIMQAGDYLDTALVFAGIIMIAAAGLTLDACLRWLLILADPSRRR |
Ga0210385_106023131 | 3300021402 | Soil | ATSGVGYLISQAGDFLDMSIVFAGIIAIAIVGLALDAGLRGLLLLADPSRRS |
Ga0210387_107563012 | 3300021405 | Soil | MQAGDYLNTALVFSGIIMIAILGLVLDACLRGLLLLADPSRRR |
Ga0210390_103007031 | 3300021474 | Soil | GDYLNTALVFSGILSIAILGLVLDACLRGLLLLADPSRRG |
Ga0208220_11323272 | 3300025627 | Arctic Peat Soil | IMQAGDYLNTALVFAGIITIAILGLALDAGLRGLLVLADPSRRR |
Ga0207710_102831881 | 3300025900 | Switchgrass Rhizosphere | IMQAGDYLNTALVFAGIITIAIAGLVLDTGLRGLLMLADPSRRR |
Ga0207671_106598391 | 3300025914 | Corn Rhizosphere | MQAGDYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR |
Ga0207693_103108251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GDYLNTALVFSGIITIAILGLALDACLRGLLLLADPSRRR |
Ga0207693_106170062 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IMQAGDYLNTALVFSGIITIAILGLILDALLRGLLLLADPSRRR |
Ga0207663_112335122 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GDYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR |
Ga0207681_114876591 | 3300025923 | Switchgrass Rhizosphere | MQAGDYLNTALVFSGIIMIAIIALVLDAWLRGLLLLADPSRRR |
Ga0207700_103894082 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAGDYLNTSLVFAGIIMIAILGLALDACLRGLLLLADPAGTQ |
Ga0209839_101123312 | 3300026294 | Soil | QAGDYLNTSLVFAGVITIAIAGLVLDACLRGLLLFVDPSRRS |
Ga0209161_102769222 | 3300026548 | Soil | IMQAGDYLNTALVFSGIIMIAIIALVLDACLRGLLLLADPSRRR |
Ga0179593_10550443 | 3300026555 | Vadose Zone Soil | MQAGDYLDTALVFAGIITIAIAGLVLDACLRGLLIAADPSRRG |
Ga0209111_10335631 | 3300027058 | Forest Soil | MQAGDYLNTALVFSGIIMIAILGLALDACLRGLLLLADPSRRR |
Ga0208099_10078033 | 3300027096 | Forest Soil | IMQAGDYLNTALVFSGILSIAILGLVLDACLRGLLLLADPSRRG |
Ga0208696_11708591 | 3300027696 | Peatlands Soil | AATTGLGYLIMQAGDYLNTALVFSGIIAIAILGLALDACLRVLLLLADPSRRR |
Ga0209448_102579481 | 3300027783 | Bog Forest Soil | LGYLIMQAGDYLNTALVFSGIIMIAILGLALDACLRGLLLLADPSRRR |
Ga0209274_102792292 | 3300027853 | Soil | QAGDYLNTALVLSGIICIAVIALTLDACLRGLLLLADPSRRG |
Ga0209169_104845681 | 3300027879 | Soil | LIMQAGDYLNVALVFSGIITIAIMGLALDAGLRGMLYLADPSKRG |
Ga0209624_104438603 | 3300027895 | Forest Soil | GDYLNTALVLSGIICIAVIALILDACLRGLLLLADPSRRG |
Ga0302151_101332671 | 3300028562 | Bog | TSLVFAGIITIAIAGLVLDACLRGLLLFVDPSRRS |
Ga0302151_102287621 | 3300028562 | Bog | AGDYLNTALVLSGIICIALIALVLDACIRGLLLLADPSRRG |
Ga0308309_102249732 | 3300028906 | Soil | YLIGQAGDYLNIALVFSGLICIALIALTLDACIRGLLLLTDPSRRT |
Ga0310037_101359013 | 3300030494 | Peatlands Soil | YLNIALVFSGLICIALIALTLDACIRGLLLLTDPSRRT |
Ga0310038_102715772 | 3300030707 | Peatlands Soil | YLNTALVFSGIIAIAILGLALDACLRVLLLLADPSRRR |
Ga0318496_100828861 | 3300031713 | Soil | LNTALVFSGIIMIAILGLVLDACLRGLLLLADPSRRR |
Ga0311301_100812649 | 3300032160 | Peatlands Soil | LNIALVFSGLICIALIALTLDACIRGLLLLTDPSRRT |
Ga0311301_110732772 | 3300032160 | Peatlands Soil | MQAGDYLDTALVFAGIITIAITGLALDAGLRGLLILADPSRRG |
Ga0311301_114253131 | 3300032160 | Peatlands Soil | AGDYLNTALVFSGIICIALIALALDACIRGLLLLADPSRRG |
Ga0335085_101284052 | 3300032770 | Soil | MIMQAGDYLNTALVFAGIIMIALAGLILDGCLRGLLILADPSRRR |
Ga0335085_113654853 | 3300032770 | Soil | MIMQAGDYLNTALVFAGIIMIALAGLILDGCLRGLLVLADPSRRR |
Ga0335079_103813773 | 3300032783 | Soil | MIMQAGDYLNTALVFAGIITIALAGLILDGCLRGLLVLADPSRRR |
Ga0335074_101086562 | 3300032895 | Soil | MQAGDYLNTALVFSGIIAIAILGLALDACLRGLLLLADPSRRG |
Ga0335072_101060865 | 3300032898 | Soil | DYLDTALVFAGILVIAVTALVIDVGLRGLLLLADPSRRG |
Ga0335072_112416561 | 3300032898 | Soil | YLIMQAGDYLNTALVFSGIIMIAILGLALDACLRGLLLLADPSRRR |
Ga0335073_103724771 | 3300033134 | Soil | TNGVGYLIMQAGDYLNVALVFSGIIAIAIMGLTLDACLRGLLYLADPSKRQ |
Ga0335073_110315182 | 3300033134 | Soil | TALVFSGIIMIAILGLALDACLRGLLLLADPSRRR |
Ga0316213_10151311 | 3300033546 | Roots | AGDYLNTALVFSGIIAIAIVALILDACLRGLLLLADPGRRG |
⦗Top⦘ |