Basic Information | |
---|---|
Family ID | F083125 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 41 residues |
Representative Sequence | FLPILVRQRDHARDHGQTDRAALFDGLIQRAETGPATTERS |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.77 % |
% of genes near scaffold ends (potentially truncated) | 96.46 % |
% of genes from short scaffolds (< 2000 bps) | 93.81 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.796 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.053 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.248 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (37.168 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF00582 | Usp | 3.54 |
PF00196 | GerE | 1.77 |
PF01564 | Spermine_synth | 1.77 |
PF13443 | HTH_26 | 0.88 |
PF13365 | Trypsin_2 | 0.88 |
PF13160 | DUF3995 | 0.88 |
PF12006 | DUF3500 | 0.88 |
PF12697 | Abhydrolase_6 | 0.88 |
PF00753 | Lactamase_B | 0.88 |
PF13649 | Methyltransf_25 | 0.88 |
PF13384 | HTH_23 | 0.88 |
PF09137 | Glucodextran_N | 0.88 |
PF00005 | ABC_tran | 0.88 |
PF03992 | ABM | 0.88 |
PF08450 | SGL | 0.88 |
PF14870 | PSII_BNR | 0.88 |
PF07992 | Pyr_redox_2 | 0.88 |
PF13602 | ADH_zinc_N_2 | 0.88 |
PF00903 | Glyoxalase | 0.88 |
PF13020 | NOV_C | 0.88 |
PF05598 | DUF772 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.88 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.88 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.80 % |
Unclassified | root | N/A | 29.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZTSFBX01EC393 | Not Available | 503 | Open in IMG/M |
3300002914|JGI25617J43924_10351912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300004479|Ga0062595_100250137 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300005332|Ga0066388_100564941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1765 | Open in IMG/M |
3300005341|Ga0070691_10054565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1913 | Open in IMG/M |
3300005436|Ga0070713_100480868 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300005439|Ga0070711_101390875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300005471|Ga0070698_100536867 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300005577|Ga0068857_100055774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3506 | Open in IMG/M |
3300005591|Ga0070761_10334973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 915 | Open in IMG/M |
3300005952|Ga0080026_10132870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 711 | Open in IMG/M |
3300006173|Ga0070716_101140526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 623 | Open in IMG/M |
3300006175|Ga0070712_100893401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300006175|Ga0070712_101969799 | Not Available | 512 | Open in IMG/M |
3300009012|Ga0066710_101896168 | Not Available | 893 | Open in IMG/M |
3300009089|Ga0099828_10875849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 803 | Open in IMG/M |
3300009174|Ga0105241_12244804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300009792|Ga0126374_10201209 | Not Available | 1260 | Open in IMG/M |
3300010043|Ga0126380_10076594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1920 | Open in IMG/M |
3300010047|Ga0126382_12538088 | Not Available | 500 | Open in IMG/M |
3300010326|Ga0134065_10479718 | Not Available | 514 | Open in IMG/M |
3300010358|Ga0126370_12107729 | Not Available | 554 | Open in IMG/M |
3300010361|Ga0126378_13232211 | Not Available | 518 | Open in IMG/M |
3300010373|Ga0134128_10345053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1664 | Open in IMG/M |
3300012200|Ga0137382_10611805 | Not Available | 778 | Open in IMG/M |
3300012205|Ga0137362_11774944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300012208|Ga0137376_10209612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1687 | Open in IMG/M |
3300012210|Ga0137378_10995634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300012351|Ga0137386_10631166 | Not Available | 771 | Open in IMG/M |
3300012353|Ga0137367_11180814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300012359|Ga0137385_10106681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus obscurus | 2481 | Open in IMG/M |
3300012923|Ga0137359_11153372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
3300012951|Ga0164300_11026266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300012986|Ga0164304_10255630 | Not Available | 1177 | Open in IMG/M |
3300015373|Ga0132257_103373831 | Not Available | 581 | Open in IMG/M |
3300016294|Ga0182041_10221002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
3300016319|Ga0182033_11973363 | Not Available | 531 | Open in IMG/M |
3300016371|Ga0182034_11737483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300016404|Ga0182037_10854729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
3300016422|Ga0182039_12245187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300017657|Ga0134074_1303062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300017821|Ga0187812_1001224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 8884 | Open in IMG/M |
3300017928|Ga0187806_1225047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300017943|Ga0187819_10624060 | Not Available | 610 | Open in IMG/M |
3300017966|Ga0187776_10585559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300017974|Ga0187777_10872463 | Not Available | 646 | Open in IMG/M |
3300017995|Ga0187816_10262529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300018007|Ga0187805_10583900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 527 | Open in IMG/M |
3300018012|Ga0187810_10417654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 565 | Open in IMG/M |
3300018090|Ga0187770_10894300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
3300018433|Ga0066667_10330059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1202 | Open in IMG/M |
3300020581|Ga0210399_10173899 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
3300021401|Ga0210393_10529049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 963 | Open in IMG/M |
3300021478|Ga0210402_11696285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 558 | Open in IMG/M |
3300021479|Ga0210410_10327786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1373 | Open in IMG/M |
3300025909|Ga0207705_10035717 | Not Available | 3555 | Open in IMG/M |
3300025910|Ga0207684_10539451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
3300025915|Ga0207693_10415626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1051 | Open in IMG/M |
3300025929|Ga0207664_11117364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300025938|Ga0207704_11568749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300025982|Ga0208139_1010212 | Not Available | 1002 | Open in IMG/M |
3300026217|Ga0209871_1126821 | Not Available | 501 | Open in IMG/M |
3300026552|Ga0209577_10197120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium kansasii | 1549 | Open in IMG/M |
3300031572|Ga0318515_10713295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300031573|Ga0310915_10512652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300031640|Ga0318555_10741119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300031668|Ga0318542_10257928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
3300031668|Ga0318542_10613111 | Not Available | 568 | Open in IMG/M |
3300031679|Ga0318561_10053931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2019 | Open in IMG/M |
3300031679|Ga0318561_10338469 | Not Available | 825 | Open in IMG/M |
3300031680|Ga0318574_10717018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
3300031681|Ga0318572_10391906 | Not Available | 825 | Open in IMG/M |
3300031682|Ga0318560_10392814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300031708|Ga0310686_108428707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
3300031708|Ga0310686_110475693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 533 | Open in IMG/M |
3300031713|Ga0318496_10709656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
3300031713|Ga0318496_10753505 | Not Available | 537 | Open in IMG/M |
3300031719|Ga0306917_10925285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
3300031723|Ga0318493_10871610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300031724|Ga0318500_10616175 | Not Available | 551 | Open in IMG/M |
3300031724|Ga0318500_10708564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300031736|Ga0318501_10627872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300031753|Ga0307477_11089174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300031765|Ga0318554_10155315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1300 | Open in IMG/M |
3300031765|Ga0318554_10433259 | Not Available | 745 | Open in IMG/M |
3300031769|Ga0318526_10440700 | Not Available | 532 | Open in IMG/M |
3300031777|Ga0318543_10538958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300031779|Ga0318566_10250311 | Not Available | 878 | Open in IMG/M |
3300031780|Ga0318508_1106877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 780 | Open in IMG/M |
3300031798|Ga0318523_10001887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7096 | Open in IMG/M |
3300031805|Ga0318497_10456802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
3300031835|Ga0318517_10278797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 755 | Open in IMG/M |
3300031894|Ga0318522_10105053 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300031896|Ga0318551_10504799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
3300031912|Ga0306921_12298875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
3300031942|Ga0310916_10513999 | Not Available | 1020 | Open in IMG/M |
3300032009|Ga0318563_10361587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
3300032025|Ga0318507_10244737 | Not Available | 778 | Open in IMG/M |
3300032025|Ga0318507_10487307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300032039|Ga0318559_10209477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300032039|Ga0318559_10305298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
3300032054|Ga0318570_10133365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
3300032059|Ga0318533_10183289 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300032059|Ga0318533_10818731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
3300032060|Ga0318505_10559048 | Not Available | 538 | Open in IMG/M |
3300032066|Ga0318514_10608919 | Not Available | 581 | Open in IMG/M |
3300032076|Ga0306924_12255018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300032076|Ga0306924_12277213 | Not Available | 550 | Open in IMG/M |
3300032089|Ga0318525_10439829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300032261|Ga0306920_101419447 | Not Available | 994 | Open in IMG/M |
3300032261|Ga0306920_103131122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
3300032828|Ga0335080_10341565 | Not Available | 1617 | Open in IMG/M |
3300032896|Ga0335075_10101960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3755 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.77% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.77% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025982 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes) | Environmental | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_08744870 | 2170459024 | Grass Soil | VLVRQRDHARDHGQADRAALFDGLIQRAETGPATTTDTGRS |
JGI25617J43924_103519122 | 3300002914 | Grasslands Soil | RAGTEFLPILVRQRDHARDHSQPDRAALFDGLIQRAGTGPATTERS* |
Ga0062595_1002501372 | 3300004479 | Soil | VSCGTEFLPILIRQRDHARHHGQAGRAALFDGLIQRAETERS* |
Ga0066388_1005649411 | 3300005332 | Tropical Forest Soil | QFLPILVRQRDHARDHGQAGRAALFDGLIQRAEARPATTDTGRS* |
Ga0070691_100545651 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | PVLVRQRDHARDHGQADRAALFDRLVQHAQAGPATTERS* |
Ga0070713_1004808681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | FLPVLVRQRDHARGHGQPDRAALFDGLIQRAKASPATTERS* |
Ga0070711_1013908751 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RTGTEFLPVLVRQRDHARDHGQADRAALFDGLIQRAGTGPATTERS* |
Ga0070698_1005368671 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TEFLPVLVRQRDHARDHGQPDRAALFDGLIQRAGAGPATTERS* |
Ga0068857_1000557745 | 3300005577 | Corn Rhizosphere | FRTGTEFLPVLVRQRDHARDHGQADRAALFDRLVQHAQAGPATTERS* |
Ga0070761_103349733 | 3300005591 | Soil | TRQRDHARDHGQADRATLFDGLIKRAEAGPATTDTGRS* |
Ga0080026_101328702 | 3300005952 | Permafrost Soil | TGTQFLPILTRQRDHARDHDQADRAALLDGLIQRAGAGPATTEQS* |
Ga0070716_1011405261 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AYFRTGTEFLPILVRQRDHARDHGQPGRAALFDGLIQHAEAGPATTERS* |
Ga0070712_1008934013 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRQRDHARDHGQPDRTALFDGLIQRAEAGPATPEGS* |
Ga0070712_1019697991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RQRDHARDHGQADRAALFDGLIHRAEAGPGTTDTGRS* |
Ga0066710_1018961681 | 3300009012 | Grasslands Soil | FRTSTQFLPILARQRDHARDHGQAERTALSGGLIQHAQTERS |
Ga0099828_108758491 | 3300009089 | Vadose Zone Soil | FLPILTRQRDHARDHGQADRAALFDGLIQRAEAAPATTGRS* |
Ga0105241_122448042 | 3300009174 | Corn Rhizosphere | FLPILIRQRDHARDHSQADRAALFDGLIQRAETGPATTGRS* |
Ga0126374_102012093 | 3300009792 | Tropical Forest Soil | HTGTQFLPILTRQRDHAQDHGQADRAALFEGLIQRAATERS* |
Ga0126380_100765944 | 3300010043 | Tropical Forest Soil | QFLPILARQRDHAQEHGQTERAALFEGLIQRAGRETP* |
Ga0126382_125380882 | 3300010047 | Tropical Forest Soil | TKFLPILTRQRDHARDHGQADRAALFDRAALFDGLIQRAGTGPASTERS* |
Ga0134065_104797182 | 3300010326 | Grasslands Soil | RTSTQFLPILACQRDHARDHGQAERTALFDGLIQQAQTERS* |
Ga0126370_121077292 | 3300010358 | Tropical Forest Soil | GPQFLPILTRQRDHAQDHGQADRAALFEELIQRAATERS* |
Ga0126378_132322112 | 3300010361 | Tropical Forest Soil | GTEFLPILTRQRDHARGHGQAERAALFDRLIQRAETERS* |
Ga0134128_103450531 | 3300010373 | Terrestrial Soil | YFRTGTEFLPILIRQRDHARDHGQPGRAALFDGLIQRAQTGPDTTGRS* |
Ga0137382_106118051 | 3300012200 | Vadose Zone Soil | RQRDHARDHGQASRAVLFDGLIQRAEAGPATTERS* |
Ga0137362_117749441 | 3300012205 | Vadose Zone Soil | FLPILVRQRDHARDHGQPDRAALFDGLIQRAGTGPATTGRS* |
Ga0137376_102096121 | 3300012208 | Vadose Zone Soil | TQFLLILVRQRDRAVNLGEAERAALFDGLIQHARTTEGS* |
Ga0137378_109956343 | 3300012210 | Vadose Zone Soil | VQFLPTLTRQRDHARDHGQTERAALFDGLIQRADTEES* |
Ga0137386_106311663 | 3300012351 | Vadose Zone Soil | RQRDHARDHGQTDRAALFDGLIQRAEAGPATTERS* |
Ga0137367_111808142 | 3300012353 | Vadose Zone Soil | TGTEFLPILVRQRDHARDHGQTDRAALFDGLVQHAGAGLATTERS* |
Ga0137385_101066811 | 3300012359 | Vadose Zone Soil | LPILTRQRDHAQDHGQNDRAALFDDLIQRASTDRS* |
Ga0137359_111533723 | 3300012923 | Vadose Zone Soil | GAPQFLPILVRQRDHARDHGQTDRATLFEGLIQRAEAGPATTERS* |
Ga0164300_110262662 | 3300012951 | Soil | FLPVLVRQRDHARDHGQADRAALFDGLIQRAEAGPATTEGS* |
Ga0164304_102556301 | 3300012986 | Soil | IRQRDHARDHGQTDRAALFDGLIHRAEAGPATTEGS* |
Ga0132257_1033738312 | 3300015373 | Arabidopsis Rhizosphere | TGTQFLPILTRQRDHARNHGQAERAALFDGLIQHAETERS* |
Ga0182041_102210023 | 3300016294 | Soil | TQLLPILVRQRDHARDHGQADRAALFDGLIHRAQAGPATTERS |
Ga0182033_119733632 | 3300016319 | Soil | FRTGTDFLPVLVRQPDYARGHGQADRAALFDGLIQRAETGPATTGRS |
Ga0182034_117374831 | 3300016371 | Soil | RTGTEFLPILVRQRDHARDHGQAGRAALFDGLIQRAETGPAATERS |
Ga0182037_108547292 | 3300016404 | Soil | TQFLPILVRQRDHARDHGQTDRAALFDGLIHRAETERS |
Ga0182039_122451871 | 3300016422 | Soil | TEFLPILVRQRDHARDHGQAGRAALFDGLIQRAETGPAATERS |
Ga0134074_13030621 | 3300017657 | Grasslands Soil | LPILTRQRDHAQDHGQADRAALFEGLIQRAATERS |
Ga0187812_10012241 | 3300017821 | Freshwater Sediment | TCACFRTGTEFLPILVRQRDHARDHSQADRAALFDGLIKRAEAGPATTERS |
Ga0187806_12250471 | 3300017928 | Freshwater Sediment | TEFLPILVHQRDHARDHGQADRAALFDGLIQRAEAGPATTERS |
Ga0187819_106240601 | 3300017943 | Freshwater Sediment | LVHQRDHARDHGQADRAALFDGLIQRAGTGPATTDTGRS |
Ga0187776_105855591 | 3300017966 | Tropical Peatland | TGAEFLPVLVRQRDQARDHGQADRAALFDGLIQRAGTGPATTDTGRS |
Ga0187777_108724631 | 3300017974 | Tropical Peatland | VLIRQRDHARDHGQAGRAALFDGLIQRAETGPATTERS |
Ga0187816_102625293 | 3300017995 | Freshwater Sediment | FLPILVRQRDHARDHGQTDRAALFDGLIQRAETGPATTERS |
Ga0187805_105839001 | 3300018007 | Freshwater Sediment | FRTGTQFLPILTRQRDHARDHGQNDRAELFDGLIQRTGTGPATTERS |
Ga0187810_104176542 | 3300018012 | Freshwater Sediment | GTEFLPILVRQRDHARDHGQTDRAALFDGLIQHAETGPATERS |
Ga0187770_108943001 | 3300018090 | Tropical Peatland | YFRTSTQFLPILARQRDHARDHGQTDRAALFDGLIQRAETDRS |
Ga0066667_103300591 | 3300018433 | Grasslands Soil | PILVRQRDHARDHGQPDRAALFDGLIQRTDTGPATTGRN |
Ga0210399_101738994 | 3300020581 | Soil | TRQRDHARDHGQTDRAALFDGLIQRAGTGPATTERS |
Ga0210393_105290493 | 3300021401 | Soil | LTRQRDHARDHGQADRTTLFDGLIQRAEAGPATTERS |
Ga0210402_116962852 | 3300021478 | Soil | FRTGTEFLPILIRQRDHARDHSQADRAALFDGLIQRAETGPATTGRS |
Ga0210410_103277863 | 3300021479 | Soil | TGTQFLPILVRQRDHARDHGQTDRATLFDGLIQRAEAGAPWHTRHLTRSPV |
Ga0207705_100357171 | 3300025909 | Corn Rhizosphere | FLPVLVRQRDHARDHGQADRAALFDRLVQHAQAGPATTERS |
Ga0207684_105394512 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LITGTEFLPILVRQRDHDHADRAALFVGLIGRVSR |
Ga0207693_104156263 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRQRDHARDHGQPDRTALFDGLIQRAEAGPATPEGS |
Ga0207664_111173643 | 3300025929 | Agricultural Soil | PVLVRQRDHARDHSQADRAALFDGLIQRAGAGPATTERS |
Ga0207704_115687492 | 3300025938 | Miscanthus Rhizosphere | FRTGTEFLPILIRQRDHARDHGQPGRAALFDGLIQHAEAGPATTERS |
Ga0208139_10102123 | 3300025982 | Rice Paddy Soil | QFLPVLTRQRDHARGHGQADRAALFDGLIQRAGTERS |
Ga0209871_11268211 | 3300026217 | Permafrost Soil | RQRDHARDHDQADRAALLDGLIQRAGAGPATTEQS |
Ga0209577_101971203 | 3300026552 | Soil | YFRTGTQFLPVLVRQRDHARDHDQAERAALFDGLIQRAETERS |
Ga0318515_107132951 | 3300031572 | Soil | FRTGTEFLPILVRQRDHARDHGQADRAALFDGLIQRAEAGPATTERS |
Ga0310915_105126523 | 3300031573 | Soil | FRTGTEFLPILVRQRDHARDHGQAGRAALFDGLIQRAETGPATTDTGRS |
Ga0318555_107411191 | 3300031640 | Soil | GTEFLPILVRQRDHARDHGQAGRAALFDGLIQRAETGPATTDTGRS |
Ga0318542_102579281 | 3300031668 | Soil | EFLPILVRQRDHARDHGQAGRAALFDGLIQPAGTGSATTERS |
Ga0318542_106131113 | 3300031668 | Soil | FRTGTQFLPILTRQRNHAHDHGQAGRAALFDGLIARAQTQRS |
Ga0318561_100539311 | 3300031679 | Soil | GTQFLPILIRQRDHARDHGQADRAVLFDGLIQRAQTERS |
Ga0318561_103384693 | 3300031679 | Soil | PILVRQRDHARDHGQAGRAALFDGLIQRAETGPATTDTGRS |
Ga0318574_107170182 | 3300031680 | Soil | GTEFLPILTRQRDHARDHGQTDRAALFDGLIQRAGAGPATTERS |
Ga0318572_103919061 | 3300031681 | Soil | AYFRTGTQFLPILTRQRDHARDHGQAERATLFDGLIQRAQTERS |
Ga0318560_103928141 | 3300031682 | Soil | TDFLPILVRQRDHARDHGQAGRAALFDGLIQRAETGPATTDTGRS |
Ga0310686_1084287071 | 3300031708 | Soil | FLPILVRQRDHARDHSQTDRAALFDGLIQRAGTGPATTGRS |
Ga0310686_1104756931 | 3300031708 | Soil | HRHRVPALLVRQRDHARDHGQAGRAALFDGLIQRAGTGPATTGRS |
Ga0318496_107096563 | 3300031713 | Soil | ETRAYFRTGTQFLPVLVRQRDHARDHGQADRAALFDELIQRAETTQES |
Ga0318496_107535051 | 3300031713 | Soil | VLVRQRDHARDHGQADRAALFDGLIQRAGAGPATTERS |
Ga0306917_109252851 | 3300031719 | Soil | TCAYFRTGPQFLPILTSQRDHAQDHGQADRAALFDGLIRRASTERS |
Ga0318493_108716102 | 3300031723 | Soil | AYFRTGTEFLPILIRQRDHARGHGQADRAALFDGLIQRAGAAPAATDTGRS |
Ga0318500_106161752 | 3300031724 | Soil | RTGTQFLPVLVRQRDHARGHGQADRAALFDGLIQRAETERS |
Ga0318500_107085642 | 3300031724 | Soil | FRTGPQFLPILTRQRDHAHDHGQPDRAALIDELIQRASTERS |
Ga0318501_106278722 | 3300031736 | Soil | FLPVLTRQRDHAQDHGQADRAALFEGLIQRAATERS |
Ga0307477_110891741 | 3300031753 | Hardwood Forest Soil | LIRQRDHARDHHQTDRAALFDGLIQRAETGPATTERS |
Ga0318554_101553151 | 3300031765 | Soil | LVRQRDHARDHGQAGRAALFDGLIQPAGTGSATTERS |
Ga0318554_104332592 | 3300031765 | Soil | GTQFLPVLVRQRDHARGHGQADRAALFDGLIQRAETERS |
Ga0318526_104407002 | 3300031769 | Soil | FRTGTQFLPILTRQRDHARDHGQATRAALFDGLIHRAETERS |
Ga0318543_105389582 | 3300031777 | Soil | FLPILTRQRDHAHDHGQPDRAALIDELIQRASTERS |
Ga0318566_102503113 | 3300031779 | Soil | PILVRQRDHARDHGQAGRAALFDGLIQPAGTGSATTERS |
Ga0318508_11068771 | 3300031780 | Soil | TGTQFLPILTRQRDHARDHGQAERAALFDGLIQRAETERS |
Ga0318523_1000188711 | 3300031798 | Soil | LPVLVRQRDHARDHGQAGRAALFDGLIQHAETGPAATERS |
Ga0318497_104568023 | 3300031805 | Soil | LPILTRQRDHAQDRGQADRAALFDGLIQRASTERS |
Ga0318517_102787971 | 3300031835 | Soil | QFLPVLVRQRDHARGHGQADRATLFDGLIQRAETERS |
Ga0318522_101050533 | 3300031894 | Soil | FLPILTRQRDHAQDHGQADRAALFEGLIQRAATERS |
Ga0318551_105047993 | 3300031896 | Soil | FLPILVRQRDHARDHGQAGRAALFDGLIQRAGAGPATTERS |
Ga0306921_122988752 | 3300031912 | Soil | TGTEFLPILIRQRDHARDHGQAGRAALFDGLIQRAGTGPATTGRS |
Ga0310916_105139991 | 3300031942 | Soil | RQRDHARDHGQAGRAALFDGLIQRAEAGPATTERS |
Ga0318563_103615871 | 3300032009 | Soil | LPVLVRQRDHARDHGQAGRAALFDGLIQRAETGPAATERS |
Ga0318507_102447371 | 3300032025 | Soil | RTGTQFLPILTRQRDHARDHGQAARAALFDGLIHRAETERS |
Ga0318507_104873072 | 3300032025 | Soil | QFLPILTRQRDHARDHGQNDRAALFDGLIQRAETGPATTGRS |
Ga0318559_102094773 | 3300032039 | Soil | FRTGTEFLPVLVRQRDHARGHGQADRAALFDGLIQRAGAGPATTGRS |
Ga0318559_103052981 | 3300032039 | Soil | TGFLPILVRQRDHARDHGQAGRAALFDGLIQRAEAGPSTTGRS |
Ga0318570_101333653 | 3300032054 | Soil | YFRTGTQFLPILTLQRDHAQDHGQADRAALFDELIQRAGTERS |
Ga0318533_101832891 | 3300032059 | Soil | CAYFRTGTEFLPVLVRQRDHARGHGQADRAALFDGLIQRAETERS |
Ga0318533_108187312 | 3300032059 | Soil | GTQFLPILTRQRDHARDHGQAERAALFDGLIQRAETERS |
Ga0318505_105590483 | 3300032060 | Soil | ILVRQRDHARDHGQAGRAALFDGLIQRAETGPATTDTGRS |
Ga0318514_106089193 | 3300032066 | Soil | TCAYFRTGTQFLPILTRQRNHARDHGQAGRAALFDGLIARAQTQRS |
Ga0306924_122550182 | 3300032076 | Soil | SACETCAYFRTGTQFLPILTLQRDHAQDHGQADRAALFDELIQRAGTERS |
Ga0306924_122772131 | 3300032076 | Soil | LPILTRQRDHAQDHGQADRAALFDELIQRASTERS |
Ga0318525_104398292 | 3300032089 | Soil | FRTGTEFLPILVRQRDHARDHGQADRAALFDGLIQRAETGPATTERS |
Ga0306920_1014194473 | 3300032261 | Soil | ILVRQRDHARDHGQAGRAALFDGLIQPAGTGSATTERS |
Ga0306920_1031311221 | 3300032261 | Soil | TGTEFLPILVRQRDHARGHGQADRAALFDGLIQRAETERS |
Ga0335080_103415651 | 3300032828 | Soil | TQFLPVLVRQRDHARDHGQAGRAALFDGLIQRAEAGPATTEGS |
Ga0335075_101019605 | 3300032896 | Soil | VIVSTQFLPILTRQRDHARDHGQTDRAALFDGLIQRAETGPATERS |
⦗Top⦘ |