Basic Information | |
---|---|
Family ID | F082986 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 39 residues |
Representative Sequence | RPRVVPTGVPGEPVLRGAMLAAVAQARAALLASVADPQ |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 94.69 % |
% of genes from short scaffolds (< 2000 bps) | 95.58 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.177 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.203 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.434 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.478 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF04542 | Sigma70_r2 | 1.77 |
PF13424 | TPR_12 | 1.77 |
PF02687 | FtsX | 0.88 |
PF00932 | LTD | 0.88 |
PF12688 | TPR_5 | 0.88 |
PF12697 | Abhydrolase_6 | 0.88 |
PF13302 | Acetyltransf_3 | 0.88 |
PF00324 | AA_permease | 0.88 |
PF00221 | Lyase_aromatic | 0.88 |
PF00230 | MIP | 0.88 |
PF02913 | FAD-oxidase_C | 0.88 |
PF00326 | Peptidase_S9 | 0.88 |
PF00400 | WD40 | 0.88 |
PF08532 | Glyco_hydro_42M | 0.88 |
PF08031 | BBE | 0.88 |
PF01636 | APH | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.77 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.77 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.77 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.77 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.77 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.88 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.88 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.88 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.88 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.88 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.88 |
COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.18 % |
Unclassified | root | N/A | 39.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10225089 | Not Available | 621 | Open in IMG/M |
3300001305|C688J14111_10228135 | Not Available | 581 | Open in IMG/M |
3300005406|Ga0070703_10284384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
3300005439|Ga0070711_100446183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1058 | Open in IMG/M |
3300005610|Ga0070763_10254010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 954 | Open in IMG/M |
3300005764|Ga0066903_100759606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1724 | Open in IMG/M |
3300005921|Ga0070766_10007119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5675 | Open in IMG/M |
3300006028|Ga0070717_10596872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1001 | Open in IMG/M |
3300006050|Ga0075028_100592823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
3300006059|Ga0075017_100154564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1635 | Open in IMG/M |
3300006162|Ga0075030_100243099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1444 | Open in IMG/M |
3300006176|Ga0070765_100392198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1295 | Open in IMG/M |
3300006237|Ga0097621_100369236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1280 | Open in IMG/M |
3300006806|Ga0079220_11275479 | Not Available | 613 | Open in IMG/M |
3300007265|Ga0099794_10068513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1735 | Open in IMG/M |
3300009029|Ga0066793_10186965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
3300009101|Ga0105247_11313000 | Not Available | 581 | Open in IMG/M |
3300009521|Ga0116222_1056462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1706 | Open in IMG/M |
3300009521|Ga0116222_1435421 | Not Available | 572 | Open in IMG/M |
3300009545|Ga0105237_10436037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1316 | Open in IMG/M |
3300009698|Ga0116216_10543226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300010046|Ga0126384_11611617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Cryobacterium | 611 | Open in IMG/M |
3300010046|Ga0126384_11818196 | Not Available | 579 | Open in IMG/M |
3300010048|Ga0126373_12343891 | Not Available | 594 | Open in IMG/M |
3300010379|Ga0136449_101957101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
3300010379|Ga0136449_103483393 | Not Available | 600 | Open in IMG/M |
3300010396|Ga0134126_12527711 | Not Available | 558 | Open in IMG/M |
3300012207|Ga0137381_11414890 | Not Available | 588 | Open in IMG/M |
3300012207|Ga0137381_11488781 | Not Available | 569 | Open in IMG/M |
3300012349|Ga0137387_10111214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1921 | Open in IMG/M |
3300012351|Ga0137386_10891107 | Not Available | 638 | Open in IMG/M |
3300012356|Ga0137371_10486110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
3300012477|Ga0157336_1015453 | Not Available | 638 | Open in IMG/M |
3300012685|Ga0137397_10809623 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012923|Ga0137359_10741570 | Not Available | 854 | Open in IMG/M |
3300012971|Ga0126369_10011148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Alicyclobacillaceae → Alicyclobacillus → Alicyclobacillus herbarius | 6926 | Open in IMG/M |
3300013100|Ga0157373_10899016 | Not Available | 657 | Open in IMG/M |
3300015054|Ga0137420_1317432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6376 | Open in IMG/M |
3300015264|Ga0137403_10314629 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300015372|Ga0132256_100680917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1144 | Open in IMG/M |
3300015373|Ga0132257_102811818 | Not Available | 634 | Open in IMG/M |
3300016294|Ga0182041_11111124 | Not Available | 718 | Open in IMG/M |
3300016319|Ga0182033_11451465 | Not Available | 618 | Open in IMG/M |
3300016422|Ga0182039_10928312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
3300017926|Ga0187807_1051013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
3300017928|Ga0187806_1074843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1056 | Open in IMG/M |
3300017974|Ga0187777_11260408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300017994|Ga0187822_10263032 | Not Available | 597 | Open in IMG/M |
3300018035|Ga0187875_10263818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 938 | Open in IMG/M |
3300018085|Ga0187772_10913816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300020150|Ga0187768_1011030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1864 | Open in IMG/M |
3300020582|Ga0210395_11308991 | Not Available | 530 | Open in IMG/M |
3300021388|Ga0213875_10303357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
3300021401|Ga0210393_10634135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
3300021420|Ga0210394_11653938 | Not Available | 537 | Open in IMG/M |
3300021474|Ga0210390_10077438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2753 | Open in IMG/M |
3300021475|Ga0210392_11497268 | Not Available | 504 | Open in IMG/M |
3300021477|Ga0210398_11223792 | Not Available | 592 | Open in IMG/M |
3300021478|Ga0210402_11374008 | Not Available | 633 | Open in IMG/M |
3300024295|Ga0224556_1120285 | Not Available | 643 | Open in IMG/M |
3300025527|Ga0208714_1096108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300025922|Ga0207646_10224733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1696 | Open in IMG/M |
3300026078|Ga0207702_10381546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1355 | Open in IMG/M |
3300026291|Ga0209890_10222523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
3300027064|Ga0208724_1015849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
3300027765|Ga0209073_10244459 | Not Available | 696 | Open in IMG/M |
3300027817|Ga0209112_10154625 | Not Available | 771 | Open in IMG/M |
3300027855|Ga0209693_10577002 | Not Available | 532 | Open in IMG/M |
3300027862|Ga0209701_10651018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300027879|Ga0209169_10528267 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300027889|Ga0209380_10679474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
3300027905|Ga0209415_10604041 | Not Available | 812 | Open in IMG/M |
3300027908|Ga0209006_10426166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1114 | Open in IMG/M |
3300027908|Ga0209006_10596665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
3300027908|Ga0209006_10773275 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300028047|Ga0209526_10294106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1101 | Open in IMG/M |
3300030007|Ga0311338_10048704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5669 | Open in IMG/M |
3300031040|Ga0265754_1035643 | Not Available | 529 | Open in IMG/M |
3300031543|Ga0318516_10224645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1086 | Open in IMG/M |
3300031564|Ga0318573_10764348 | Not Available | 519 | Open in IMG/M |
3300031572|Ga0318515_10629732 | Not Available | 569 | Open in IMG/M |
3300031640|Ga0318555_10256473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 945 | Open in IMG/M |
3300031640|Ga0318555_10400648 | Not Available | 743 | Open in IMG/M |
3300031668|Ga0318542_10532682 | Not Available | 611 | Open in IMG/M |
3300031708|Ga0310686_108521480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
3300031713|Ga0318496_10334147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 837 | Open in IMG/M |
3300031723|Ga0318493_10641854 | Not Available | 593 | Open in IMG/M |
3300031724|Ga0318500_10348817 | Not Available | 731 | Open in IMG/M |
3300031770|Ga0318521_10220099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1101 | Open in IMG/M |
3300031778|Ga0318498_10330486 | Not Available | 682 | Open in IMG/M |
3300031782|Ga0318552_10085566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1542 | Open in IMG/M |
3300031794|Ga0318503_10120643 | Not Available | 839 | Open in IMG/M |
3300031805|Ga0318497_10105578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1515 | Open in IMG/M |
3300031805|Ga0318497_10194770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
3300031819|Ga0318568_10096391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1766 | Open in IMG/M |
3300031846|Ga0318512_10207837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 959 | Open in IMG/M |
3300031879|Ga0306919_10160256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1648 | Open in IMG/M |
3300031896|Ga0318551_10133120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1348 | Open in IMG/M |
3300032008|Ga0318562_10272878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
3300032008|Ga0318562_10486813 | Not Available | 715 | Open in IMG/M |
3300032009|Ga0318563_10624733 | Not Available | 580 | Open in IMG/M |
3300032010|Ga0318569_10489891 | Not Available | 573 | Open in IMG/M |
3300032025|Ga0318507_10210488 | Not Available | 840 | Open in IMG/M |
3300032054|Ga0318570_10120306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1160 | Open in IMG/M |
3300032054|Ga0318570_10173412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 970 | Open in IMG/M |
3300032066|Ga0318514_10199682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
3300032261|Ga0306920_103057986 | Not Available | 630 | Open in IMG/M |
3300032770|Ga0335085_11114519 | Not Available | 845 | Open in IMG/M |
3300032893|Ga0335069_11954225 | Not Available | 619 | Open in IMG/M |
3300032895|Ga0335074_10282505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1916 | Open in IMG/M |
3300032895|Ga0335074_10630878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1058 | Open in IMG/M |
3300032896|Ga0335075_10838752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
3300033134|Ga0335073_11461334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 663 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.20% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.73% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.19% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.31% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.31% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.65% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.89% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_102250892 | 3300000567 | Peatlands Soil | GASIRPSRPRVVPTGGPGEPALRGAMLAAVAQAQAALLASVADRQ* |
C688J14111_102281351 | 3300001305 | Soil | AAAVASIWPSRPRVVPTSVPGEPVLRGAMQAAVAQARTALLASVADR* |
Ga0070703_102843841 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ASIWPSRPRVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ* |
Ga0070711_1004461832 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ASIWPSRPHVVPTGVPGEPVLRGAMLAAVAQARSALLASVADPQ* |
Ga0070763_102540101 | 3300005610 | Soil | PTGVPGEPVLRGAMLAAVDQARATLLASVADPGR* |
Ga0066903_1007596062 | 3300005764 | Tropical Forest Soil | QVVPTSVTGDPVLGGAILAAVDQARGELLASVASS* |
Ga0070766_100071194 | 3300005921 | Soil | HPQVVPTAVPGEPVLRGAMLAAVDQARAALLASVADPGR* |
Ga0070717_105968722 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPTGVPGEPVLRGAMLAAVAQARSALLASVADPQ* |
Ga0075028_1005928231 | 3300006050 | Watersheds | VVPTGVPGEPVLRGAMLAAVAQARAALLASVADPQ* |
Ga0075017_1001545642 | 3300006059 | Watersheds | IWPSRPRVVPTAVPGEPVLRGAMLAAVAQARAGLLASVADPH* |
Ga0075030_1002430991 | 3300006162 | Watersheds | SRPRVVPTGVPGEPVLRGAMLAAVAQARAGLLASVADPQ* |
Ga0070765_1003921982 | 3300006176 | Soil | RPRVVPTGVPGEPVLRGAMLAAVAQARAALLASVADPQ* |
Ga0097621_1003692362 | 3300006237 | Miscanthus Rhizosphere | SRPRVVPTSVPGEPVLRGAMQAAVAQARTALLASIADR* |
Ga0079220_112754792 | 3300006806 | Agricultural Soil | PSRPRVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ* |
Ga0099794_100685132 | 3300007265 | Vadose Zone Soil | VVPTGVSGQPVLRGAILAAVEQARGELLASMAGP* |
Ga0066793_101869651 | 3300009029 | Prmafrost Soil | RPQIVPTGVSGGPVLRGAILAAVDQARKELLASVAGP* |
Ga0105247_113130001 | 3300009101 | Switchgrass Rhizosphere | PRVVPTSVPGEPVLRGAMQAAVAQARTALLASVADRQ* |
Ga0116222_10564622 | 3300009521 | Peatlands Soil | AAEVAGICPARLRVVPTGVPDEPVLRGAMLAAVGLARAALLASVADPQ* |
Ga0116222_14354211 | 3300009521 | Peatlands Soil | VVPTGVPGEPVLRGAMLAAVAQARAGLLASVADPQ* |
Ga0105237_104360372 | 3300009545 | Corn Rhizosphere | PRVVPTGVPGEPVLRGAMLAAVAQARSALLASVADPQ* |
Ga0116216_105432261 | 3300009698 | Peatlands Soil | TIVPTAITGGPVLRGAILAAVDQARSELLASVASP* |
Ga0126384_116116172 | 3300010046 | Tropical Forest Soil | PTVVPTAVDGWPVLRGAILAAVAQARAELLASVADPA* |
Ga0126384_118181961 | 3300010046 | Tropical Forest Soil | SICPSRPRVVPTGMPGVPGEPVLRGAMLAALGQARAALLASVADPQ* |
Ga0126373_123438912 | 3300010048 | Tropical Forest Soil | VVPTSVPGEPVLRGAMQAAVAQARTALLASIADR* |
Ga0136449_1019571012 | 3300010379 | Peatlands Soil | PRVVPTGVPGEPVLRGAMLAAVAQARAGLLASVADPQ* |
Ga0136449_1034833931 | 3300010379 | Peatlands Soil | ASPRVVPTAVTGAPVLRGAMLAAVDQARTDLLDSV* |
Ga0134126_125277111 | 3300010396 | Terrestrial Soil | QVVPTGISGGPVLRGAILAAVEQARAELLASVAS* |
Ga0137381_114148901 | 3300012207 | Vadose Zone Soil | IWPSRPRVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ* |
Ga0137381_114887812 | 3300012207 | Vadose Zone Soil | ASIWPSRPRVVPTSVPGEPVLRGAMQAAVTQARTALLASVADPQ* |
Ga0137387_101112142 | 3300012349 | Vadose Zone Soil | VPTSVPGEPVLRGAMLAAVAQARAALLASVADPQ* |
Ga0137386_108911071 | 3300012351 | Vadose Zone Soil | SRPRVVPTGVPGEPVLRGAMLAAVAQARSALLASVADPQ* |
Ga0137371_104861101 | 3300012356 | Vadose Zone Soil | PRVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ* |
Ga0157336_10154532 | 3300012477 | Arabidopsis Rhizosphere | RVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ* |
Ga0137397_108096231 | 3300012685 | Vadose Zone Soil | EVGRISPAHPQVVPTGVTGQPVLRRAILAALEHAPGDLLASVAGP* |
Ga0137359_107415702 | 3300012923 | Vadose Zone Soil | VVPTGIPGEPVLRGAMLAAVAQARSALLASVADPQ* |
Ga0126369_100111481 | 3300012971 | Tropical Forest Soil | VVPTAVDGAPVLRGAILAAVDQARTELLASIADPALSR* |
Ga0157373_108990162 | 3300013100 | Corn Rhizosphere | PSRPRVVPTSVPGEPVLRGAMQAAVAQARTALLASIADR* |
Ga0137420_13174323 | 3300015054 | Vadose Zone Soil | VVPTGIPGEPVLRGAMLASVAQARSALLASVADPQ* |
Ga0137403_103146292 | 3300015264 | Vadose Zone Soil | VTGGPVLCGAVLAAVDQARRDLLDSVASPLSSAS* |
Ga0132256_1006809172 | 3300015372 | Arabidopsis Rhizosphere | SRPRVVPTGVPGEPVLRGAMLAAVSQARSALLASVADPQ* |
Ga0132257_1028118181 | 3300015373 | Arabidopsis Rhizosphere | RPRVVPTGVPGEPVLRGAMLAAVSQARSALLASVADPQ* |
Ga0182041_111111243 | 3300016294 | Soil | VPGEPVLRGAMLAAVDQARAALLASVADPSSAVGR |
Ga0182033_114514652 | 3300016319 | Soil | PTGVPGEPVLRGAMLAAVDQARAALLASVADPSSAVGR |
Ga0182039_109283122 | 3300016422 | Soil | SRPRVVPTGVPGEPVLRGAMLAAVSQARAALLASVADPQ |
Ga0187807_10510132 | 3300017926 | Freshwater Sediment | AAEVAGICPARPRVVPTGVPDEPVLRGAMLAAVGLARAALLASVADPQ |
Ga0187806_10748432 | 3300017928 | Freshwater Sediment | SRPRVVPTGVPGEPVLRGAMLAAVAQARAGLLASVADPQ |
Ga0187777_112604082 | 3300017974 | Tropical Peatland | VPGEPVLRGAMLAAVDQARATLLASVADPGAPARSR |
Ga0187822_102630321 | 3300017994 | Freshwater Sediment | RVVPTSVPGEPVLRGAMQAAVAQARTALLASIADRS |
Ga0187875_102638182 | 3300018035 | Peatland | RVLPTSVPGEPVLRGAMLAAVARARTALLASVADR |
Ga0187772_109138161 | 3300018085 | Tropical Peatland | ICPARPRVVPTGVPDEPVLRGAMLAAVDLARAALLASVADPQ |
Ga0187768_10110301 | 3300020150 | Tropical Peatland | PGEPVLRGAMLAAVDQARATLLASVADPGAPARSG |
Ga0210395_113089912 | 3300020582 | Soil | RPRVVPTGVSGDPVLGGAILAAVDQARGELLASVANS |
Ga0213875_103033572 | 3300021388 | Plant Roots | PRVVPTSVTGDPVLCGAIRASVDQARQELLASVASA |
Ga0210393_106341352 | 3300021401 | Soil | PRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPGR |
Ga0210394_116539381 | 3300021420 | Soil | WPSRPRVVPTGVPGEPVLRGAMLAAVAQARSALLASVADPQ |
Ga0210390_100774382 | 3300021474 | Soil | HPRVVPTGVPDEPVLRGAMLAAVDQARAALLASVADPGR |
Ga0210392_114972681 | 3300021475 | Soil | QVVPTGVTGQPVLRGAILAAVEMARGELLASVAGP |
Ga0210398_112237922 | 3300021477 | Soil | ARPRVVPTSVTGDPVLCGAIRAAVDQARQELLASVASA |
Ga0210402_113740081 | 3300021478 | Soil | WPSRPRVVPTGVAGEPVLRGAMLAAVAQARAALLASVADPQ |
Ga0224556_11202851 | 3300024295 | Soil | VVPTGVPDEPVLRGAMLAALAQARAALLASVADPASGPAP |
Ga0208714_10961081 | 3300025527 | Arctic Peat Soil | AHPQVVPTGVTGQPVLRGAILAAVEQARGELLASVAGP |
Ga0207646_102247331 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RPRVVPTGVAGEPVLRGAMLAAVAQAHAALLASVADPQ |
Ga0207702_103815462 | 3300026078 | Corn Rhizosphere | ICPSRPRVVPTSVPGEPVLRGAMQAAVAQARTALLASIADR |
Ga0209890_102225231 | 3300026291 | Soil | RPQIVPTGVSGGPVLRGAILAAVDQARKELLASVAGP |
Ga0208724_10158492 | 3300027064 | Forest Soil | SRVAACVAAIWPSHPLVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPGR |
Ga0209073_102444592 | 3300027765 | Agricultural Soil | SRPRVVPTSVPGEPVLRGAMQAAVAQARTALLASIADR |
Ga0209112_101546252 | 3300027817 | Forest Soil | SRPRVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ |
Ga0209693_105770021 | 3300027855 | Soil | SRPRVVPTGVPGEPVLRGAMLAAVAQARSALLASVADPQ |
Ga0209701_106510182 | 3300027862 | Vadose Zone Soil | ARPRVVPTGVTGGPVLRGAILAAVDQARGELLASVAGP |
Ga0209169_105282672 | 3300027879 | Soil | RPRVVPTAVAGPPVLCGAILAAVDQARADLLDSVASPQPAAPAELPAS |
Ga0209380_106794742 | 3300027889 | Soil | PHPQVVPTAVPGEPVLRGAMLAAVDQARAALLASVADPGR |
Ga0209415_106040412 | 3300027905 | Peatlands Soil | VVPTGVPDEPVLRGAMLAAVDLARAALLASVADPQ |
Ga0209006_104261662 | 3300027908 | Forest Soil | PRVVPTGVPDEPVLRGAMLAAVDQARAGLLASVADPGR |
Ga0209006_105966653 | 3300027908 | Forest Soil | PQVVPTGVTGQPVLRGAILAAVEMARGELLASVAGP |
Ga0209006_107732751 | 3300027908 | Forest Soil | RPRVVPTAVPGEPVLRGAMLAALAQAHAALLASVADPQ |
Ga0209526_102941062 | 3300028047 | Forest Soil | ADRVAVGVASIWPSGPRVVPTVVPREPVLRGAMLAAVAQTQAGLLASVADPQ |
Ga0311338_100487041 | 3300030007 | Palsa | PRVVPTGVPGEPVLQGAMLAAVAQARAALLASVADPQ |
Ga0265754_10356432 | 3300031040 | Soil | PSRPRVVPTGVPGEPVLRGAMLAAVAQARAGLLASVADRQ |
Ga0318516_102246451 | 3300031543 | Soil | PSRPRVVPTGVPGEPVLRGAMLAAVSQARAALLASVADPQ |
Ga0318573_107643482 | 3300031564 | Soil | PRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSSAVGR |
Ga0318515_106297322 | 3300031572 | Soil | VVPTCVPGEPVLRGAMLAAVSQARTALLASVADPQ |
Ga0318555_102564732 | 3300031640 | Soil | PRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSPPQ |
Ga0318555_104006481 | 3300031640 | Soil | RVVPTGVPGEPVLRGAMLAAVSQARAALLASVADPQ |
Ga0318542_105326822 | 3300031668 | Soil | PRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSRP |
Ga0310686_1085214802 | 3300031708 | Soil | ARPRVVPTGVPDEPVLRGAMLAAVAQARAALLASVADPQ |
Ga0318496_103341471 | 3300031713 | Soil | ARPRVVPTGVPGEPVLRGAMLAAVDQARAALLASVAGPSSAAGR |
Ga0318493_106418541 | 3300031723 | Soil | VPGEPVLRGAMLAAVDQARAALLASVAGPSSAAGR |
Ga0318500_103488171 | 3300031724 | Soil | VPTGVPGEPVLRGAMLAAVDQARAALLASVAGPSSAAGR |
Ga0318521_102200991 | 3300031770 | Soil | PSRPRVVPTCVPGEPVLRGAMLAAVSQARTALLASVADPQ |
Ga0318498_103304862 | 3300031778 | Soil | PRVVPTGVPGEPVLRGAMLAALDQARAALLASVADPSSAVGR |
Ga0318552_100855661 | 3300031782 | Soil | VPTGVPGEPVLRGAMLAAVDQARAALLASVADPSPPQ |
Ga0318503_101206431 | 3300031794 | Soil | ARPRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSSAAGR |
Ga0318497_101055781 | 3300031805 | Soil | PSRPRVVPTGVPGEPVLRGAMLAAVSQAHAALLASVADPQ |
Ga0318497_101947701 | 3300031805 | Soil | GVPGEPVLRGAMLAAVDQARAALLASVADPSSAVGR |
Ga0318568_100963911 | 3300031819 | Soil | SRPRVVPTGVPGEPVLRGAMLAAVSQAHAALLASVADPQ |
Ga0318512_102078372 | 3300031846 | Soil | PRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSRPQ |
Ga0306919_101602562 | 3300031879 | Soil | RPRVVPTGVPGEPVLRGAMLAAVSQARAALLASVADPQ |
Ga0318551_101331202 | 3300031896 | Soil | WPSRPRVVPTCVPGEPVLRGAMLAAVSQARTALLASVADPQ |
Ga0318562_102728782 | 3300032008 | Soil | WPSRPRVVPTGVPGEPVLRGAMLAAVSQARAALLASVADPQ |
Ga0318562_104868131 | 3300032008 | Soil | SRPRVVPTGVPGEPVLRGAMLAAVSQARTALLASVADPQ |
Ga0318563_106247331 | 3300032009 | Soil | VVPTGVPGEPVLRGAMLAAVSQARTALLASVADPQ |
Ga0318569_104898912 | 3300032010 | Soil | VPGEPVLRGAMLAAVDQARAALLASVADASSAVGR |
Ga0318507_102104881 | 3300032025 | Soil | VVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSSAAGR |
Ga0318570_101203061 | 3300032054 | Soil | SIWPSRPRVVPTGVPGEPVLRGAMLAAVSQARTALLASVADPQ |
Ga0318570_101734121 | 3300032054 | Soil | RPRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSSAVGR |
Ga0318514_101996821 | 3300032066 | Soil | ARPRVVPTGVPGEPVLRGAMLAAVDQARAALLASVADPSSAVGR |
Ga0306920_1030579862 | 3300032261 | Soil | PSRPRVVPTGVTGEPVLRGAMLAAVAQARAALLASVATPQ |
Ga0335085_111145192 | 3300032770 | Soil | VVPTGVPGEPVLRGAMLAALGQARAALLASVADPQ |
Ga0335069_119542253 | 3300032893 | Soil | ICPARPTVVPTGVTGQPVLRGAILAAVEQARAGLLASVAAP |
Ga0335074_102825052 | 3300032895 | Soil | CPARPRVVPTGVPDEPVLRGAMLAAVAQARAALLASVADPQ |
Ga0335074_106308782 | 3300032895 | Soil | PTGVPDEPVLRGAMLAAVDQARAALLASVADPGRP |
Ga0335075_108387521 | 3300032896 | Soil | SRPHVVPTGVPGEPVLRGAMLAAVARARSALLASVADPQ |
Ga0335073_114613342 | 3300033134 | Soil | IFPASPRVVPTGVTGAPVLRGAMLAAVDQARSDLLDSV |
⦗Top⦘ |