Basic Information | |
---|---|
Family ID | F082594 |
Family Type | Metagenome |
Number of Sequences | 113 |
Average Sequence Length | 44 residues |
Representative Sequence | MKPQDVYRLEQVLRLSISQDLLNKASNFHNKDDMEEARKIVEKKH |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 63.72 % |
% of genes near scaffold ends (potentially truncated) | 46.90 % |
% of genes from short scaffolds (< 2000 bps) | 81.42 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (59.292 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.549 % of family members) |
Environment Ontology (ENVO) | Unclassified (69.027 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.566 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 80.00% β-sheet: 0.00% Coil/Unstructured: 20.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF06737 | Transglycosylas | 34.82 |
PF01844 | HNH | 8.04 |
PF00145 | DNA_methylase | 6.25 |
PF05869 | Dam | 3.57 |
PF05065 | Phage_capsid | 0.89 |
PF14279 | HNH_5 | 0.89 |
PF04860 | Phage_portal | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 6.25 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 59.29 % |
All Organisms | root | All Organisms | 40.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109350599 | Not Available | 707 | Open in IMG/M |
3300002835|B570J40625_100489570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300002845|contig_10191 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
3300003277|JGI25908J49247_10003947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4736 | Open in IMG/M |
3300003394|JGI25907J50239_1051508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300003431|JGI25913J50563_1027222 | Not Available | 902 | Open in IMG/M |
3300004240|Ga0007787_10272880 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005525|Ga0068877_10743979 | Not Available | 522 | Open in IMG/M |
3300005527|Ga0068876_10026787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3610 | Open in IMG/M |
3300005527|Ga0068876_10074221 | All Organisms → Viruses → Predicted Viral | 2047 | Open in IMG/M |
3300005527|Ga0068876_10651351 | Not Available | 567 | Open in IMG/M |
3300005580|Ga0049083_10315789 | Not Available | 522 | Open in IMG/M |
3300005581|Ga0049081_10074218 | Not Available | 1279 | Open in IMG/M |
3300005581|Ga0049081_10296706 | Not Available | 557 | Open in IMG/M |
3300005582|Ga0049080_10069155 | Not Available | 1212 | Open in IMG/M |
3300005584|Ga0049082_10213690 | Not Available | 658 | Open in IMG/M |
3300005805|Ga0079957_1051261 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
3300005805|Ga0079957_1370285 | Not Available | 619 | Open in IMG/M |
3300006639|Ga0079301_1085085 | Not Available | 981 | Open in IMG/M |
3300006805|Ga0075464_10549977 | Not Available | 708 | Open in IMG/M |
3300006875|Ga0075473_10391517 | Not Available | 562 | Open in IMG/M |
3300006917|Ga0075472_10266702 | Not Available | 844 | Open in IMG/M |
3300006920|Ga0070748_1345156 | Not Available | 525 | Open in IMG/M |
3300007162|Ga0079300_10098253 | Not Available | 843 | Open in IMG/M |
3300007538|Ga0099851_1105808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
3300007735|Ga0104988_10315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13388 | Open in IMG/M |
3300007973|Ga0105746_1126019 | Not Available | 853 | Open in IMG/M |
3300008120|Ga0114355_1045198 | Not Available | 2049 | Open in IMG/M |
3300008122|Ga0114359_1017256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3001 | Open in IMG/M |
3300008263|Ga0114349_1082192 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
3300008263|Ga0114349_1171102 | Not Available | 832 | Open in IMG/M |
3300008266|Ga0114363_1028228 | Not Available | 2394 | Open in IMG/M |
3300008266|Ga0114363_1191444 | Not Available | 638 | Open in IMG/M |
3300008450|Ga0114880_1058372 | All Organisms → Viruses → Predicted Viral | 1605 | Open in IMG/M |
3300008450|Ga0114880_1095434 | Not Available | 1160 | Open in IMG/M |
3300009085|Ga0105103_10199730 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
3300009085|Ga0105103_10761685 | Not Available | 560 | Open in IMG/M |
3300009152|Ga0114980_10300937 | Not Available | 930 | Open in IMG/M |
3300009152|Ga0114980_10726829 | Not Available | 555 | Open in IMG/M |
3300009152|Ga0114980_10818620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
3300009155|Ga0114968_10298227 | Not Available | 902 | Open in IMG/M |
3300009161|Ga0114966_10326768 | Not Available | 919 | Open in IMG/M |
3300009170|Ga0105096_10532987 | Not Available | 613 | Open in IMG/M |
3300009180|Ga0114979_10810482 | Not Available | 525 | Open in IMG/M |
3300009181|Ga0114969_10234341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
3300009181|Ga0114969_10618530 | Not Available | 592 | Open in IMG/M |
3300009184|Ga0114976_10233992 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
3300010160|Ga0114967_10032459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3483 | Open in IMG/M |
3300010354|Ga0129333_10003307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15079 | Open in IMG/M |
3300010370|Ga0129336_10001272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15223 | Open in IMG/M |
3300010370|Ga0129336_10001272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15223 | Open in IMG/M |
3300010370|Ga0129336_10202538 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
3300010885|Ga0133913_12127223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300011010|Ga0139557_1074108 | Not Available | 568 | Open in IMG/M |
3300012012|Ga0153799_1034647 | Not Available | 959 | Open in IMG/M |
3300013005|Ga0164292_10242474 | Not Available | 1259 | Open in IMG/M |
3300017701|Ga0181364_1074720 | Not Available | 518 | Open in IMG/M |
3300017716|Ga0181350_1036262 | Not Available | 1345 | Open in IMG/M |
3300017722|Ga0181347_1079655 | Not Available | 957 | Open in IMG/M |
3300017722|Ga0181347_1120005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300017722|Ga0181347_1184519 | Not Available | 555 | Open in IMG/M |
3300017736|Ga0181365_1008048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2613 | Open in IMG/M |
3300017736|Ga0181365_1023847 | Not Available | 1542 | Open in IMG/M |
3300017754|Ga0181344_1191217 | Not Available | 576 | Open in IMG/M |
3300017761|Ga0181356_1112056 | Not Available | 878 | Open in IMG/M |
3300017766|Ga0181343_1197714 | Not Available | 551 | Open in IMG/M |
3300017774|Ga0181358_1138392 | Not Available | 841 | Open in IMG/M |
3300017777|Ga0181357_1022042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2532 | Open in IMG/M |
3300017780|Ga0181346_1010278 | Not Available | 4018 | Open in IMG/M |
3300019784|Ga0181359_1000220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12063 | Open in IMG/M |
3300019784|Ga0181359_1104286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300020527|Ga0208232_1003371 | All Organisms → Viruses → Predicted Viral | 2748 | Open in IMG/M |
3300020544|Ga0207937_1026865 | Not Available | 906 | Open in IMG/M |
3300020553|Ga0208855_1030943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300020556|Ga0208486_1007941 | All Organisms → Viruses → Predicted Viral | 1698 | Open in IMG/M |
3300020560|Ga0208852_1036191 | Not Available | 868 | Open in IMG/M |
3300020561|Ga0207934_1001677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3263 | Open in IMG/M |
3300020571|Ga0208723_1052748 | Not Available | 558 | Open in IMG/M |
3300022179|Ga0181353_1022882 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
3300022407|Ga0181351_1091647 | Not Available | 1191 | Open in IMG/M |
3300022407|Ga0181351_1108585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1060 | Open in IMG/M |
3300025896|Ga0208916_10102290 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
3300027499|Ga0208788_1052483 | Not Available | 1083 | Open in IMG/M |
3300027642|Ga0209135_1257859 | Not Available | 515 | Open in IMG/M |
3300027659|Ga0208975_1015297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2578 | Open in IMG/M |
3300027688|Ga0209553_1173293 | Not Available | 718 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1078708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1564 | Open in IMG/M |
3300027736|Ga0209190_1062089 | Not Available | 1836 | Open in IMG/M |
3300027759|Ga0209296_1162630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 991 | Open in IMG/M |
3300027763|Ga0209088_10254733 | Not Available | 727 | Open in IMG/M |
3300027770|Ga0209086_10355899 | Not Available | 604 | Open in IMG/M |
3300027772|Ga0209768_10444030 | Not Available | 504 | Open in IMG/M |
3300027782|Ga0209500_10139528 | Not Available | 1153 | Open in IMG/M |
3300027808|Ga0209354_10279077 | Not Available | 667 | Open in IMG/M |
3300027963|Ga0209400_1057828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1971 | Open in IMG/M |
3300027973|Ga0209298_10321144 | Not Available | 599 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10229530 | Not Available | 1015 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10228436 | Not Available | 1029 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10161617 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
3300031758|Ga0315907_10163870 | Not Available | 1878 | Open in IMG/M |
3300031787|Ga0315900_10452184 | Not Available | 992 | Open in IMG/M |
3300031951|Ga0315904_10217698 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
3300032093|Ga0315902_10682810 | Not Available | 840 | Open in IMG/M |
3300032116|Ga0315903_10047558 | All Organisms → Viruses → Predicted Viral | 4399 | Open in IMG/M |
3300033981|Ga0334982_0538880 | Not Available | 511 | Open in IMG/M |
3300034012|Ga0334986_0104422 | All Organisms → Viruses → Predicted Viral | 1693 | Open in IMG/M |
3300034062|Ga0334995_0804646 | Not Available | 514 | Open in IMG/M |
3300034062|Ga0334995_0813184 | Not Available | 510 | Open in IMG/M |
3300034073|Ga0310130_0024922 | All Organisms → Viruses → Predicted Viral | 1878 | Open in IMG/M |
3300034073|Ga0310130_0028768 | Not Available | 1722 | Open in IMG/M |
3300034073|Ga0310130_0042003 | All Organisms → Viruses → Predicted Viral | 1381 | Open in IMG/M |
3300034073|Ga0310130_0113262 | Not Available | 819 | Open in IMG/M |
3300034092|Ga0335010_0071613 | All Organisms → Viruses → Predicted Viral | 2400 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.55% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.85% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.31% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.31% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.42% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.54% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.54% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 3.54% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.65% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.77% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.77% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.89% |
Stormwater Retention Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond | 0.89% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002845 | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Crim Dell | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020544 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1093505991 | 3300002408 | Freshwater | MRPQDVYRLEQVLRLSISQDLLNKASNFHNKDDMEEARKIVEKK |
B570J40625_1004895701 | 3300002835 | Freshwater | MKPQDVYRLEQVLRLSISQDLLNRQADFHDKRDMEEARKIVEKKH* |
contig_101912 | 3300002845 | Stormwater Retention Pond | MKPQEVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH* |
JGI25908J49247_1000394710 | 3300003277 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRAQDFRNKDDMEEARKIVEQKH* |
JGI25907J50239_10515083 | 3300003394 | Freshwater Lake | KGGRMKPQDQYRFEKALRASISIDLKNREKNFKNKKDMEEARKIVEQKH* |
JGI25913J50563_10272221 | 3300003431 | Freshwater Lake | MDYKDVYRLEKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH* |
Ga0007787_102728803 | 3300004240 | Freshwater Lake | MKPQDQYRFEKALRASISIDLKNREKDFQNKNDMEEARKIVEQKH* |
Ga0068877_107439792 | 3300005525 | Freshwater Lake | MKPQDVYKLEQVLRLSISQDLLNKASNFHNQDDMEEARKIVEKKH* |
Ga0068876_100267871 | 3300005527 | Freshwater Lake | MKPQDVYKLEQVLRLSISQDLLNKASNFHNQDDMEEARKIVEKK |
Ga0068876_100742214 | 3300005527 | Freshwater Lake | MKPQDVYRLEQVLRLSISQDLLNKSSNFHNQDDMEEARKIVEKKH* |
Ga0068876_106513512 | 3300005527 | Freshwater Lake | MKPQDVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH* |
Ga0049083_103157892 | 3300005580 | Freshwater Lentic | MDYKDVYRVEQALRASISYDLLNRAQDFRNQDDMEEARKIVEQKH* |
Ga0049081_100742181 | 3300005581 | Freshwater Lentic | MDYKDVYRVEQALRASISYDLLNRRQDFRNQDDMEEARKI |
Ga0049081_102967061 | 3300005581 | Freshwater Lentic | LGEGGKMKPQDQYRFEKALRASITLDLKNREKDFKNKDDMEEARKIVEQKH* |
Ga0049080_100691552 | 3300005582 | Freshwater Lentic | MKPQDVYKLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH* |
Ga0049082_102136901 | 3300005584 | Freshwater Lentic | GKGGRMKPQDQYRFERALRASISIDLKNREKDFKNKDDMEEARKIVEQKH* |
Ga0079957_10512614 | 3300005805 | Lake | MKPQDVYRLEQVLRLSISQDLLSKASNFHNKDDMEEARKIVEKKH* |
Ga0079957_13702853 | 3300005805 | Lake | MKPQDVYKLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKK |
Ga0079301_10850853 | 3300006639 | Deep Subsurface | MKPQDQYRFERALRASISIDLKNREKDFKNKKDMEEARKIVEQKH* |
Ga0075464_105499773 | 3300006805 | Aqueous | MEKVLRASISQDLLNKASNFHNRDDMEEARKIVEQKH* |
Ga0075473_103915172 | 3300006875 | Aqueous | MKPQDVYRLEQVLRLSISQDLLSKQSNFQSKEDMEEARKIVEKKH* |
Ga0075472_102667022 | 3300006917 | Aqueous | MKPQDVYRLEQVLRLSISQDLLSKQSNFQSKQDMEEARKIVEKKH* |
Ga0070748_13451562 | 3300006920 | Aqueous | MKPQDVYKLEQVLRLSISQDLLNKASNFYNRDDMEEARKIVEKKH* |
Ga0079300_100982532 | 3300007162 | Deep Subsurface | MKPQDVYRLEQVLRLSISQDLLNKASNFHNKDDMEEARKIVEKKH* |
Ga0099851_11058083 | 3300007538 | Aqueous | MKPQDVYKLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVE |
Ga0104988_103157 | 3300007735 | Freshwater | MKPQEVYKLEQILRLSISQDLLSKASNFHNRDDMEEARKIVEKKH* |
Ga0105746_11260193 | 3300007973 | Estuary Water | MDYKDVYRMEKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH* |
Ga0114355_10451983 | 3300008120 | Freshwater, Plankton | MKPQDVYRLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH* |
Ga0114359_10172567 | 3300008122 | Freshwater, Plankton | MKPQDVYRLEQVLRLSISQDLLNRQADFHDKRDMEEARKIVE |
Ga0114349_10821924 | 3300008263 | Freshwater, Plankton | ATIRHKKGGLMKPQDVYRLEQVLRLSISQDLLNRQADFHDKRDMEEARKIVEKKH* |
Ga0114349_11711021 | 3300008263 | Freshwater, Plankton | ATIRHKKGGLMKPQDVYRLEQVLRLSISQDLLNRQADFNDKRDMEEARKIVEKKN* |
Ga0114363_10282281 | 3300008266 | Freshwater, Plankton | MKPQDVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEK |
Ga0114363_11914441 | 3300008266 | Freshwater, Plankton | MKPQDVYRLEQVLRLSISQDLLNRASNFHNQDDMEEARKIVEKKH* |
Ga0114880_10583722 | 3300008450 | Freshwater Lake | MKPQDVYRFEQVLRLSISQDLLSKQSNFQSKEDMEEARKIVEKKH* |
Ga0114880_10954341 | 3300008450 | Freshwater Lake | YRLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH* |
Ga0105103_101997301 | 3300009085 | Freshwater Sediment | VLRLSISQDLLNKSSNFHNQDDMEEARKIVEKKH* |
Ga0105103_107616853 | 3300009085 | Freshwater Sediment | KTKKGGRMKPQDVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH* |
Ga0114980_103009374 | 3300009152 | Freshwater Lake | MKPQDQYRFEKALRASISLDLKNREKDFQNKNDMEEARKIVEQKH* |
Ga0114980_107268292 | 3300009152 | Freshwater Lake | MTPQEQYRFERALRASISIDLLNRQKDFKNKKDMEEARKIVEQKH* |
Ga0114980_108186201 | 3300009152 | Freshwater Lake | MKPQDVYRLEKVLRASISYDLLNRQADFHDKHDMEEARKIVEQKH* |
Ga0114968_102982271 | 3300009155 | Freshwater Lake | VLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH* |
Ga0114966_103267683 | 3300009161 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRAQDFRNKDDMEEARKIVEKKH* |
Ga0105096_105329872 | 3300009170 | Freshwater Sediment | YKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH* |
Ga0114979_108104821 | 3300009180 | Freshwater Lake | MNSKEQYRFEKALRASISIDLKNRQADFHDKHDMEEARKIVEQKH* |
Ga0114969_102343411 | 3300009181 | Freshwater Lake | RFEKALRASISLDLKNREKDFQNKNDMEEARKIVEQKH* |
Ga0114969_106185303 | 3300009181 | Freshwater Lake | CYSRCICDNKTRKGGLMKPQEVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH* |
Ga0114976_102339921 | 3300009184 | Freshwater Lake | EKVLRASISQDLLNRRNEFRNQDDMEEARKIVEQKH* |
Ga0114967_100324596 | 3300010160 | Freshwater Lake | MKPQDQYRFEKALRASISLDLKYREKDFQNKNDMEEARKIVEQKH* |
Ga0129333_100033075 | 3300010354 | Freshwater To Marine Saline Gradient | MKPQDVYRLEQVLRLSISQDLLSKQSNFHSKEDMEEARKIVEKKH* |
Ga0129336_100012721 | 3300010370 | Freshwater To Marine Saline Gradient | DVYRLEQVLRLSISQDLLSKQSNFHSKEDMEEARKIVEKKH* |
Ga0129336_1000127227 | 3300010370 | Freshwater To Marine Saline Gradient | MKPQDVYRLEQVLRLSISQDLLSKQSNFHSKEDMEEARKIVEKK |
Ga0129336_102025383 | 3300010370 | Freshwater To Marine Saline Gradient | MKPQDVYRLEQVLRLSISQDLLNKQSNFHSKADMEEARKIVEKKH* |
Ga0133913_121272234 | 3300010885 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRRNDFRNQDDMEEARKIVEQKH* |
Ga0139557_10741082 | 3300011010 | Freshwater | MKPQDVYRMEKVLRASISQDLLNKASNFHNRDDMEEARKIVEQKH* |
Ga0153799_10346471 | 3300012012 | Freshwater | MKPQDVYRLEQVLRLSISQDLLNKQSNFQSKEDMEEARKIVEKKH* |
Ga0164292_102424743 | 3300013005 | Freshwater | MKPQDQYRFEKALRASISIDLKNREKDFKNKKDMEEARKIVEQKH* |
Ga0181364_10747201 | 3300017701 | Freshwater Lake | KALRASISIDLKNREKDFKNKDDMEEARKIVEQKH |
Ga0181350_10362623 | 3300017716 | Freshwater Lake | VYRVEQALRASISYDLLNRRQDFRNQDDMEEARKIVEQKH |
Ga0181347_10796551 | 3300017722 | Freshwater Lake | IRHRKGGKMDYKDVYRVEQALRASISYDLLNRAQDFRNKDDMEEARKIVEQKH |
Ga0181347_11200053 | 3300017722 | Freshwater Lake | MKPQDQYRFERALRASISIDLKNREKDFRNKDDMEEARKIVEQKH |
Ga0181347_11845191 | 3300017722 | Freshwater Lake | EKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH |
Ga0181365_10080484 | 3300017736 | Freshwater Lake | MDYQDVYRVEQALRASISYDLLNRAQDFRNKDDMEEARKIVEQKH |
Ga0181365_10238474 | 3300017736 | Freshwater Lake | ATIVFGKGGKMDYQDVYRVEQALRASISYDLLNRRQDFRNQDDMEEARKIVEQKN |
Ga0181344_11912171 | 3300017754 | Freshwater Lake | TIILGKGGRMKPQDVYRLEQVLRLSISQDLLSKQSNFQSKEDMEEARKIVEKKH |
Ga0181356_11120563 | 3300017761 | Freshwater Lake | MDYQDVYRVEQALRASISYDLLNRAQDFRNQDDMEEARKIVEQKH |
Ga0181343_11977141 | 3300017766 | Freshwater Lake | KALRASISIDLKNREKDFKNKKDMEEARKIVEQKH |
Ga0181358_11383921 | 3300017774 | Freshwater Lake | VYRVEQALRASISYDLLNRAKDFRNKDDMEEARKIVEQKH |
Ga0181357_10220426 | 3300017777 | Freshwater Lake | MDYQDVYRVEQALRASISYDLLNRRQDFRNQDDMEEARKI |
Ga0181346_10102781 | 3300017780 | Freshwater Lake | MDYKDVYRVEKALRASISYDLLNRAQDFRNKDDMEEARKIVEQKH |
Ga0181359_100022022 | 3300019784 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRAQDFRNKDDMEEARKIVEQKH |
Ga0181359_11042862 | 3300019784 | Freshwater Lake | MKPQDQYRFEKALRASISIDLKNREKNFKNKKDMEEARKIVEQKH |
Ga0208232_10033715 | 3300020527 | Freshwater | MKPQDVYRLEQVLRLSISQDLLNRQADFHDKRDMEEARKIVEKKH |
Ga0207937_10268651 | 3300020544 | Freshwater | QVLRLSISQDLLNRQADFHDKRDMEEARKIVEKKH |
Ga0208855_10309432 | 3300020553 | Freshwater | YWRYICDNKTKKGGRMKPQDVYRLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH |
Ga0208486_10079414 | 3300020556 | Freshwater | MKPQDVYRLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH |
Ga0208852_10361911 | 3300020560 | Freshwater | KTKKGGLMKPQDVYRLEQVLRLSISQDLLNKASNFHNKDDMEEARKIVEKKH |
Ga0207934_10016773 | 3300020561 | Freshwater | MDYKDVYRLEKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH |
Ga0208723_10527481 | 3300020571 | Freshwater | LMKPQDVYRLEQVLRLSISQDLLNRQADFHDKRDMEEARKIVEKKH |
Ga0181353_10228822 | 3300022179 | Freshwater Lake | MKPQDQYRFERALRASISIDLKNREKDFKNKNDMEEARKIVEQKH |
Ga0181351_10916473 | 3300022407 | Freshwater Lake | MDYQDVYRVEQALRASISYDLLNRRQDFRNQDDMEEARKIVEQKH |
Ga0181351_11085853 | 3300022407 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRAQDFRNQDDMEEARKIVEQKH |
Ga0208916_101022901 | 3300025896 | Aqueous | CICDNKTRKGGLMKPQEVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH |
Ga0208788_10524834 | 3300027499 | Deep Subsurface | DVYRMEKVLRASISQDLLNKASNFHNRDDMEEARKIVEQKH |
Ga0209135_12578592 | 3300027642 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRAQDFRNKDDMQEARKIVEQKH |
Ga0208975_10152976 | 3300027659 | Freshwater Lentic | MKPQDVYRLEKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH |
Ga0209553_11732932 | 3300027688 | Freshwater Lake | MDYQDVYRVEQALRASISYDLLNRAKDFRNKDDMEEARKIVEQKH |
(restricted) Ga0247833_10787083 | 3300027730 | Freshwater | MDYKDVYRLEKVLRLSISQDLLNKASNFHNRDDMEEARKIVEQKH |
Ga0209190_10620893 | 3300027736 | Freshwater Lake | MKPQDQYRFERALRASISIDLKNREKDFKNKKDMEEARKIVEQKH |
Ga0209296_11626301 | 3300027759 | Freshwater Lake | MDYKDVYRMEKVLRASISQDLLNRRNEFRNQDDMEEARKIVEQK |
Ga0209088_102547332 | 3300027763 | Freshwater Lake | MKPQDVYRLEKVLRASISYDLLNRQADFHDKHDMEEARKIVEQKH |
Ga0209086_103558991 | 3300027770 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRAQDFRNKDDMEEARKIVEKKH |
Ga0209768_104440302 | 3300027772 | Freshwater Lake | MDYKDVYRVEQALRASISYDLLNRRQDFRNQDDMEEARKIVEQKH |
Ga0209500_101395281 | 3300027782 | Freshwater Lake | MKPQEVYKLEQVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH |
Ga0209354_102790771 | 3300027808 | Freshwater Lake | DVYRLEKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH |
Ga0209400_10578282 | 3300027963 | Freshwater Lake | MDYKDVYRMEKVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH |
Ga0209298_103211441 | 3300027973 | Freshwater Lake | MDYKDVYRMEKVLRASISQDLLNRRNEFRNQDDMEEARKIVEQKH |
(restricted) Ga0247840_102295302 | 3300028581 | Freshwater | MDYKDVYRLEKVLRLSISQDLLNKASNFHNKDDMEEARKIVEQKH |
(restricted) Ga0247842_102284361 | 3300029268 | Freshwater | RKGGKMDYKDVYRVEQALRASISYDLLNRAKNFRNQDDMEEARKIVEQKH |
(restricted) Ga0247841_101616174 | 3300029286 | Freshwater | MDYKDVYRVEQALRASISYDLLNRAKNFRNQDDMEEARKIVEQKH |
Ga0315907_101638701 | 3300031758 | Freshwater | YICDNKTKKGGRMKPQDVYKLEQVLRLSISQDLLNKASNFHNQDDMEEARKIVEKKH |
Ga0315900_104521841 | 3300031787 | Freshwater | YRLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH |
Ga0315904_102176982 | 3300031951 | Freshwater | MKPQDVYKLEQVLRLSISQDLLSKASNFHNQDDMEEARKIVEKKH |
Ga0315902_106828103 | 3300032093 | Freshwater | QVLRLSISQDLLNKASNFHNRDDMEEARKIVEKKH |
Ga0315903_100475586 | 3300032116 | Freshwater | MKPQDVYRLEQVLRLSISQDLLSKASNFNNKDDMEEARKIVEKKH |
Ga0334982_0538880_3_110 | 3300033981 | Freshwater | KVLRASISQDLLNRRNDFRNQDDMEEARKIVEQKH |
Ga0334986_0104422_1150_1287 | 3300034012 | Freshwater | MKPQDQYRFEKALRASISIDLKNREKDFKNKKDMEEARKIVEQKH |
Ga0334995_0804646_2_109 | 3300034062 | Freshwater | MDYKDVYRLEKVLRASISQDLLNRRNDFRNQDDMEE |
Ga0334995_0813184_371_508 | 3300034062 | Freshwater | MKPQDVYRLEQVLRLSISQDLLNKSSNFHNQDDMEEARKIVEKKH |
Ga0310130_0024922_1759_1878 | 3300034073 | Fracking Water | YRLEQVLRLSISQDLLNRQADFHDKRDMEEARKIVEKKH |
Ga0310130_0028768_1064_1201 | 3300034073 | Fracking Water | MKPQDVYRLEQVLRLSISQDLLNKQSNFHSKEDMEEARKIVEKKH |
Ga0310130_0042003_1223_1381 | 3300034073 | Fracking Water | KTKKGGRMKPQDVYKLEQVLRLSISQDLLNKASNFHNQDDMEEARKIVEKKH |
Ga0310130_0113262_635_772 | 3300034073 | Fracking Water | MKPQDVYKLEQVLRLSISQDLLNKASNFHSKEDMEEARKIVEKKH |
Ga0335010_0071613_2292_2399 | 3300034092 | Freshwater | MKPQDVYRLEQVLRLSISQDLLSKQSNFQSKEDMEE |
⦗Top⦘ |