Basic Information | |
---|---|
Family ID | F082456 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 113 |
Average Sequence Length | 45 residues |
Representative Sequence | RVEVDQATDACVNEPLPEPETALPGVYVDPPAADKLWFKSL |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 113 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.89 % |
% of genes near scaffold ends (potentially truncated) | 97.35 % |
% of genes from short scaffolds (< 2000 bps) | 84.07 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.841 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.664 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.938 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.327 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 0.00% Coil/Unstructured: 86.96% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 113 Family Scaffolds |
---|---|---|
PF02779 | Transket_pyr | 46.90 |
PF02780 | Transketolase_C | 23.89 |
PF03544 | TonB_C | 8.85 |
PF00364 | Biotin_lipoyl | 7.08 |
PF02817 | E3_binding | 6.19 |
PF02811 | PHP | 1.77 |
PF07386 | DUF1499 | 0.88 |
PF13561 | adh_short_C2 | 0.88 |
PF00676 | E1_dh | 0.88 |
PF03706 | LPG_synthase_TM | 0.88 |
PF00198 | 2-oxoacid_dh | 0.88 |
PF00578 | AhpC-TSA | 0.88 |
COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 8.85 |
COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 7.08 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.88 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.88 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.88 |
COG4446 | Uncharacterized conserved protein, DUF1499 family | Function unknown [S] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.84 % |
Unclassified | root | N/A | 14.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001086|JGI12709J13192_1001283 | All Organisms → cellular organisms → Bacteria | 3922 | Open in IMG/M |
3300002908|JGI25382J43887_10416541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
3300004480|Ga0062592_101429533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 660 | Open in IMG/M |
3300005179|Ga0066684_10283771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1096 | Open in IMG/M |
3300005180|Ga0066685_10082252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2127 | Open in IMG/M |
3300005343|Ga0070687_101355782 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005445|Ga0070708_101049015 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 764 | Open in IMG/M |
3300005450|Ga0066682_10194824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1298 | Open in IMG/M |
3300005450|Ga0066682_10774912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 582 | Open in IMG/M |
3300005451|Ga0066681_10632628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 656 | Open in IMG/M |
3300005451|Ga0066681_10950619 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005454|Ga0066687_10075580 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
3300005471|Ga0070698_100012904 | All Organisms → cellular organisms → Bacteria | 8849 | Open in IMG/M |
3300005530|Ga0070679_101300398 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005556|Ga0066707_10024506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3254 | Open in IMG/M |
3300005566|Ga0066693_10098937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1050 | Open in IMG/M |
3300005713|Ga0066905_100114753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1865 | Open in IMG/M |
3300005880|Ga0075298_1022066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
3300005890|Ga0075285_1065810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 504 | Open in IMG/M |
3300006034|Ga0066656_10683099 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300006794|Ga0066658_10400019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 744 | Open in IMG/M |
3300006844|Ga0075428_100012272 | All Organisms → cellular organisms → Bacteria | 9527 | Open in IMG/M |
3300006852|Ga0075433_10336746 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300006853|Ga0075420_101570054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 564 | Open in IMG/M |
3300006880|Ga0075429_100981234 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300006904|Ga0075424_100293133 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
3300006914|Ga0075436_101174528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 579 | Open in IMG/M |
3300006954|Ga0079219_10783669 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300006954|Ga0079219_10978803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 698 | Open in IMG/M |
3300007255|Ga0099791_10355046 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300007258|Ga0099793_10101420 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1332 | Open in IMG/M |
3300009012|Ga0066710_100023620 | All Organisms → cellular organisms → Bacteria | 6919 | Open in IMG/M |
3300009012|Ga0066710_100122177 | All Organisms → cellular organisms → Bacteria | 3551 | Open in IMG/M |
3300009088|Ga0099830_10487293 | Not Available | 1004 | Open in IMG/M |
3300009100|Ga0075418_10496901 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300009137|Ga0066709_100085863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3781 | Open in IMG/M |
3300009137|Ga0066709_104677307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
3300010046|Ga0126384_10855624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 818 | Open in IMG/M |
3300010320|Ga0134109_10469217 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300010325|Ga0134064_10378847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 560 | Open in IMG/M |
3300010326|Ga0134065_10254255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 656 | Open in IMG/M |
3300010329|Ga0134111_10179391 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300010362|Ga0126377_12616166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 580 | Open in IMG/M |
3300010399|Ga0134127_10345197 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300011270|Ga0137391_11540758 | Not Available | 509 | Open in IMG/M |
3300012198|Ga0137364_11368308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
3300012200|Ga0137382_10443616 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 918 | Open in IMG/M |
3300012201|Ga0137365_10592887 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300012203|Ga0137399_10538871 | Not Available | 980 | Open in IMG/M |
3300012205|Ga0137362_10017157 | All Organisms → cellular organisms → Bacteria | 5489 | Open in IMG/M |
3300012207|Ga0137381_10322461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1346 | Open in IMG/M |
3300012208|Ga0137376_10830813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 794 | Open in IMG/M |
3300012225|Ga0137434_1071299 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012285|Ga0137370_10452323 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300012349|Ga0137387_10855670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 658 | Open in IMG/M |
3300012351|Ga0137386_11152471 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
3300012353|Ga0137367_10324674 | Not Available | 1098 | Open in IMG/M |
3300012359|Ga0137385_11471970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 545 | Open in IMG/M |
3300012378|Ga0134025_1160276 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300012397|Ga0134056_1343931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
3300012405|Ga0134041_1008777 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 715 | Open in IMG/M |
3300012407|Ga0134050_1398210 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012410|Ga0134060_1384849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 539 | Open in IMG/M |
3300012532|Ga0137373_10143173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2026 | Open in IMG/M |
3300012898|Ga0157293_10266971 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012917|Ga0137395_10148012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1605 | Open in IMG/M |
3300012923|Ga0137359_10829492 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300012925|Ga0137419_10033368 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
3300012927|Ga0137416_10184562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1662 | Open in IMG/M |
3300012927|Ga0137416_10414294 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300012948|Ga0126375_10794189 | Not Available | 749 | Open in IMG/M |
3300012960|Ga0164301_10659000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 781 | Open in IMG/M |
3300014150|Ga0134081_10222004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 650 | Open in IMG/M |
3300014157|Ga0134078_10070159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1256 | Open in IMG/M |
3300015054|Ga0137420_1341695 | Not Available | 9588 | Open in IMG/M |
3300015241|Ga0137418_10071386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3165 | Open in IMG/M |
3300015245|Ga0137409_11407519 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 543 | Open in IMG/M |
3300015264|Ga0137403_11371245 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300015357|Ga0134072_10173708 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300017656|Ga0134112_10083121 | Not Available | 1191 | Open in IMG/M |
3300017659|Ga0134083_10162951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 907 | Open in IMG/M |
3300017939|Ga0187775_10402816 | Not Available | 566 | Open in IMG/M |
3300018031|Ga0184634_10401551 | Not Available | 625 | Open in IMG/M |
3300018433|Ga0066667_12180835 | Not Available | 515 | Open in IMG/M |
3300018468|Ga0066662_10650335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 997 | Open in IMG/M |
3300019789|Ga0137408_1146924 | Not Available | 1033 | Open in IMG/M |
3300019882|Ga0193713_1011271 | Not Available | 2705 | Open in IMG/M |
3300024241|Ga0233392_1027721 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 602 | Open in IMG/M |
3300024288|Ga0179589_10101700 | Not Available | 1175 | Open in IMG/M |
3300025324|Ga0209640_11369550 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300025918|Ga0207662_11174496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
3300025921|Ga0207652_11351055 | Not Available | 616 | Open in IMG/M |
3300026089|Ga0207648_10375512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1285 | Open in IMG/M |
3300026307|Ga0209469_1105958 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300026310|Ga0209239_1090261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1312 | Open in IMG/M |
3300026323|Ga0209472_1203631 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300026324|Ga0209470_1371790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300026333|Ga0209158_1145017 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300026333|Ga0209158_1249577 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300026334|Ga0209377_1294829 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300026540|Ga0209376_1070523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1901 | Open in IMG/M |
3300026542|Ga0209805_1003493 | All Organisms → cellular organisms → Bacteria | 8937 | Open in IMG/M |
3300026548|Ga0209161_10152812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1331 | Open in IMG/M |
3300026548|Ga0209161_10198962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1110 | Open in IMG/M |
3300027882|Ga0209590_10372686 | Not Available | 921 | Open in IMG/M |
3300028784|Ga0307282_10183629 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300028884|Ga0307308_10077921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1569 | Open in IMG/M |
3300031421|Ga0308194_10021588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1417 | Open in IMG/M |
3300031576|Ga0247727_10094723 | All Organisms → cellular organisms → Bacteria | 3180 | Open in IMG/M |
3300031576|Ga0247727_10165020 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2106 | Open in IMG/M |
3300032205|Ga0307472_100235156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1424 | Open in IMG/M |
3300033407|Ga0214472_10322660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1465 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 18.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.08% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.77% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.77% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.77% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.77% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.89% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.89% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12709J13192_10012837 | 3300001086 | Forest Soil | ATDACVDEPLPDPESALPGVYMDPPAADKLWFRAI* |
JGI25382J43887_104165412 | 3300002908 | Grasslands Soil | IDDRVRVEVDQATDACVNEPLPEGETALPGVYVDPPSADRLWFKSL* |
Ga0062592_1014295332 | 3300004480 | Soil | QRILSADLVSEADLKDIDERVRVEVDQATDACVDEPLPPADTALTGVQVDPPAADKLWFKAL* |
Ga0066684_102837711 | 3300005179 | Soil | VRAEIDEATDACVDEPLPQGETALPGVYANPRAAERLWFRSL* |
Ga0066685_100822521 | 3300005180 | Soil | DDRVRVEVDQATDACVNEPLPTPESALPGVYVDPPAADKLWFKVL* |
Ga0070687_1013557821 | 3300005343 | Switchgrass Rhizosphere | VSEADLKDIDERVRVEVDQATDACVDEPLPSADTALTGVQVDPPAADQLWFKAL* |
Ga0070708_1010490152 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TQRILSADLVSEADLKDIDERVRVEVDQATDACVDEPLPSADTALTGVQVDPPAADKLWFKAL* |
Ga0066682_101948241 | 3300005450 | Soil | LLAADRVAEGDLKDIDDRVRVEVDQATDACVDEPLPEPQTALPSVYVDPPAAGKLWFKSL |
Ga0066682_107749121 | 3300005450 | Soil | HKELTDIDDRVRVEVDQATDACVDEPLPAAETALPGVYVDPPAADKLWFKAL* |
Ga0066681_106326282 | 3300005451 | Soil | DDRVRVEVDQATDACVNEPLPDPESALPGVYVQPPSADKLWFKSL* |
Ga0066681_109506192 | 3300005451 | Soil | ERDLSGVDERARAEIDEATDACVDEPLPGGETALPGVYVNPPAADRLWFRSL* |
Ga0066687_100755803 | 3300005454 | Soil | DLVAEADLTDIDGRVRVEVDQATDACVNEPLPPAESALPGVYVEPAAADALWFKSL* |
Ga0070698_1000129041 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVEVDQATDACVDEPLPPAESALPGVYVDPPAADKLWFKVL* |
Ga0070679_1013003982 | 3300005530 | Corn Rhizosphere | RVRVEVDQATDACVDEPLPAAESALPGVYVDPPAADKLWFKTL* |
Ga0066707_100245061 | 3300005556 | Soil | EVDEHVRVQIDEATDACVDEPLPQGETALPGVYANPRAAERLWFRNL* |
Ga0066693_100989371 | 3300005566 | Soil | ADLTDIDGRVRVEVDQATDACVNEPLPPAESALPGVYVEPAAADALWFKSL* |
Ga0066905_1001147531 | 3300005713 | Tropical Forest Soil | RLRSGDLVGEGGLKEIDERVRVEVDQATDACVNEPLPPAETALPGVYVDPPAADRLWFKAL* |
Ga0075298_10220662 | 3300005880 | Rice Paddy Soil | IDQATDACVNEPLPQPETALPGVYAHPPAAERLWFRGL* |
Ga0075285_10658101 | 3300005890 | Rice Paddy Soil | EATDACVNEPLPPVDSALPGVYVDPPAADTLWFKSV* |
Ga0066656_106830991 | 3300006034 | Soil | SDLKDIDDRVRDEVDQATDACVDEPLPQAETALPRVYLDPPVADRLWFKRL* |
Ga0066658_104000192 | 3300006794 | Soil | ATDQRIRDEVDRATDACVDEPLPAPETALGGVYADPADTEKLWFRLL* |
Ga0075428_1000122721 | 3300006844 | Populus Rhizosphere | VRVEVDQATDACMNEPLPPAETALPGVYVNPPAADRLWFKAL* |
Ga0075433_103367461 | 3300006852 | Populus Rhizosphere | VDQATDACVNEPLPAAESALPGVYVDPPAADKLWFKDL* |
Ga0075420_1015700541 | 3300006853 | Populus Rhizosphere | ELDRTVKDEVDQATDACVNDPLPAPQTALPGVYAHPAAADRLWFRLL* |
Ga0075429_1009812341 | 3300006880 | Populus Rhizosphere | QATDACVDEPLPAADTALPGVYVDPPAADKLWFKTL* |
Ga0075424_1002931333 | 3300006904 | Populus Rhizosphere | TDKDLTDIDDRVRIEVDQATDACVDEPLPAAETALPGVYVDPPAADQLWFKAL* |
Ga0075436_1011745282 | 3300006914 | Populus Rhizosphere | DEIDEATDACVNEPLPPGDSALPDVYAEPPAAPHLWFRGL* |
Ga0079219_107836691 | 3300006954 | Agricultural Soil | TDACVNEPLPPGDSALPGVYADPPASPRLWYRGGES* |
Ga0079219_109788031 | 3300006954 | Agricultural Soil | LVSEADLKDIDDRVRVEVDRATDACVNEPPPEAESALPGVYDNPASADKLWFKSL* |
Ga0099791_103550462 | 3300007255 | Vadose Zone Soil | RVRVEVDQATDACVNESLPTPESALPGVYVDPPAADTLWFKVL* |
Ga0099793_101014201 | 3300007258 | Vadose Zone Soil | TDACVNEPLPQPETTLPGVYASPPAAERLWFRSL* |
Ga0066710_1000236201 | 3300009012 | Grasslands Soil | IDEATDACVDEPLPQGETALPGVYANPRAAERLWFRSL |
Ga0066710_1001221776 | 3300009012 | Grasslands Soil | LKDIDDRVRVEVDQATDACVNEPLPTPESALPGVYVDPPAADKLWFKVL |
Ga0099830_104872932 | 3300009088 | Vadose Zone Soil | QNEWVEEGELTAIDAGVQDEVDQATDACVDEPLPPGESALADVYADLPTAAALWFRRV* |
Ga0075418_104969011 | 3300009100 | Populus Rhizosphere | RRLAELDRVVKEEIDQATDACVNEPLPPPESALPGVTANPPAAERLWFRAS* |
Ga0066709_1000858631 | 3300009137 | Grasslands Soil | IDEATDACVDEPLPQGETALPGVYANPRAAERLWFRSL* |
Ga0066709_1046773071 | 3300009137 | Grasslands Soil | QATDACVDEPLPPPETALGGVYADPADTERLWFRLL* |
Ga0126384_108556242 | 3300010046 | Tropical Forest Soil | VKDEVDQATDACVNEPLPSGETSLTGVYADPVATPRLWYRES* |
Ga0134109_104692171 | 3300010320 | Grasslands Soil | TDACVNEPLPDPESALPGVYVQPPSADKLWFKSL* |
Ga0134064_103788472 | 3300010325 | Grasslands Soil | GDLKDIDDRVRVEVDQATDACVDEPLPPAESALPGVYVDPAAADKLWFKAL* |
Ga0134065_102542552 | 3300010326 | Grasslands Soil | YTQRVLAADLVAEGDLKDIDDRVRVEVDQATDACVNEPLPDPESALPGVYVQPPSADKLWFKSL* |
Ga0134111_101793911 | 3300010329 | Grasslands Soil | QATDACVDDPLPPPESALPGVYASPAAAARLWFRSL* |
Ga0134062_101320631 | 3300010337 | Grasslands Soil | IDQATDACVDEPLPAGDSALGGVFAQPPTTDQLWFRALS* |
Ga0126377_126161662 | 3300010362 | Tropical Forest Soil | EVDQATDACVNEPLPSGETALTGVYADPVATPHLWYRES* |
Ga0134127_103451971 | 3300010399 | Terrestrial Soil | DIDAAVRDEVDQATDSCVNDPLPEPVSALDDVYANPPRAERLWFRK* |
Ga0137391_115407581 | 3300011270 | Vadose Zone Soil | TDACAEERLPAPESALPGVYADPPAAEALWFRGLS* |
Ga0137364_113683081 | 3300012198 | Vadose Zone Soil | DEVDQATDACVDEPLPPPETALGGVYADPADTEQLWFRLL* |
Ga0137382_104436161 | 3300012200 | Vadose Zone Soil | DIDDRVRVEVDQATDACVDEPLPAAETALPGVYVEPPAADKLWFKAL* |
Ga0137365_105928872 | 3300012201 | Vadose Zone Soil | RVEVDQATDACVDEPLPLAESALPGVYVDPPAANKLWFKAL* |
Ga0137399_105388712 | 3300012203 | Vadose Zone Soil | DEVDQATDGCVNEPLPEGETALGAVFAQPAAAERLWYRSI* |
Ga0137362_1001715710 | 3300012205 | Vadose Zone Soil | EVDQATDACVNEPLPTPESALPGVYVDPPAADKLWFKVL* |
Ga0137381_103224613 | 3300012207 | Vadose Zone Soil | RVEVDQATDACVDEPLPPAESALPGVYVDPPAANKLWFKAL* |
Ga0137376_108308133 | 3300012208 | Vadose Zone Soil | RVEIDQATDASADAPLPEPETALPGVYVNPAAAEKLWFRSV* |
Ga0137434_10712991 | 3300012225 | Soil | KDEVDRATDACVNDPLPAPQTALPGVYAHPAAAERLWFRML* |
Ga0137370_104523233 | 3300012285 | Vadose Zone Soil | VDLKDIDERVRTEVDQATDACVNEPLPEPESALPGVYENPPAAERLW |
Ga0137387_108556702 | 3300012349 | Vadose Zone Soil | DLKDIDDRVRVEVDQATDACVDEPLPPAESALPGVYIDPPAAGKLWFKVL* |
Ga0137386_111524712 | 3300012351 | Vadose Zone Soil | KDIDDRVRVEVDQATDACVDEPLPEAETALPEVYVDPPAADKLWFKVL* |
Ga0137367_103246741 | 3300012353 | Vadose Zone Soil | DRVRVEVDQATDACVDEPLPPAESALPGVYVDPPAADKLWFKAL* |
Ga0137385_114719701 | 3300012359 | Vadose Zone Soil | RVEVDQATDACVNEPLPEPETALPGVYVDPPAADKLWFKSL* |
Ga0134025_11602762 | 3300012378 | Grasslands Soil | VEVDQATDACVNEPLPDPESALPGVYVQPPSADKLWFKSL* |
Ga0134056_13439311 | 3300012397 | Grasslands Soil | EGDLKDIDDRVRVEVDQATDACMDEPLPPAESALPGVYVDPPGADKLWFKVL* |
Ga0134041_10087771 | 3300012405 | Grasslands Soil | EIDQATDACVNEPLPPPESALPGVYASPAAAARLWFRSL* |
Ga0134050_13982102 | 3300012407 | Grasslands Soil | DIDAGVRAEIDQATDACVNEPLPPPESALPGVYASPAAAARLWFRSL* |
Ga0134060_13848492 | 3300012410 | Grasslands Soil | VRVEVDQATDACVNYPLPTSESALPGVYVDPPSADKLWFKVL* |
Ga0137373_101431731 | 3300012532 | Vadose Zone Soil | NDERVRVEVDEATDACVDEPLPAGETALSGVYASPPPAAAAPHWYRSL* |
Ga0157293_102669711 | 3300012898 | Soil | VDQATDACVDEPLPSADTALTGVQVDPPAADQLWFKAL* |
Ga0137395_101480121 | 3300012917 | Vadose Zone Soil | TDACVNEPLPEGETALGAVFAQPAAAERLWYRSI* |
Ga0137359_108294923 | 3300012923 | Vadose Zone Soil | DLKDIDDRVRVEVDQATDMCADEPLPPAESALPGVYVEPAAADKLWFKLL* |
Ga0137419_100333681 | 3300012925 | Vadose Zone Soil | ATDACVNEPLPIPESALPGVYVDPPAADTLWFKVL* |
Ga0137416_101845623 | 3300012927 | Vadose Zone Soil | LKDIDDRVRVEVDQATDACVDEPLPAAETALPGVYVDPPAADKLWFKAL* |
Ga0137416_104142941 | 3300012927 | Vadose Zone Soil | DLVTEADLKDIDDRVRVEVDQATDACVNEPLPDGESALPGVYVEPPAADKLWFKAL* |
Ga0126375_107941892 | 3300012948 | Tropical Forest Soil | TDACVDEPLPQPDTALPGVYATPASADRLWFRSL* |
Ga0164301_106590002 | 3300012960 | Soil | EVDQATDACVNEPLPEGDTALGAVFAQPAAAERLWYRSI* |
Ga0134081_102220041 | 3300014150 | Grasslands Soil | RDLSGVDERARAEIDEATDTSVDEPLPQGETALAGVYVNPPAADRLWFRGL* |
Ga0134078_100701591 | 3300014157 | Grasslands Soil | TDACVDEPLPPAEIALPGVYVDPPAADKLWFRVL* |
Ga0137420_134169518 | 3300015054 | Vadose Zone Soil | RAVEVDQATDACVDEPLPAAENRVAGVYVDPPAADKLWFKAL* |
Ga0137418_100713866 | 3300015241 | Vadose Zone Soil | VEVDQATDECVDEPLPEGDTALPGVYVDPPAADKLWFKAP* |
Ga0137409_114075192 | 3300015245 | Vadose Zone Soil | VDEATDACVDEPVPEPESALPAVYASPATAERLWFRGL* |
Ga0137403_113712451 | 3300015264 | Vadose Zone Soil | QATDACVNEPLPTPESALPGVYVDPPAADKLWFKVL* |
Ga0134072_101737082 | 3300015357 | Grasslands Soil | RAEIDEATDACVDEPLPQGETALPGVYANPRAAERLWFRSL* |
Ga0134112_100831212 | 3300017656 | Grasslands Soil | DQATDACVNEPLPEPETALPGVYVDPPAADKLWFKSL |
Ga0134083_101629512 | 3300017659 | Grasslands Soil | ATDACVDEPLPPAESALPGVYIDPPAADKLWFKVL |
Ga0187775_104028161 | 3300017939 | Tropical Peatland | GDVRDEIDQATEACENEPLPPAESSLTGVYVHPPAAQRLWFRGTHG |
Ga0184634_104015511 | 3300018031 | Groundwater Sediment | VDQATDACVDEPLPAGETALPDVYADPPAADKLWFRTV |
Ga0066667_121808352 | 3300018433 | Grasslands Soil | VRTEVDQATDACVNEPLPEPESALPGVYENPPAAERLWFKSL |
Ga0066662_106503351 | 3300018468 | Grasslands Soil | ATDHRIRDEVDRATDACVDEPLPAPETALGGVYADPADTEKLWFRLL |
Ga0137408_11469241 | 3300019789 | Vadose Zone Soil | VEVDQATDACVNESLPTPESALPGVYVDPPAADKLWFKVL |
Ga0193713_10112714 | 3300019882 | Soil | RVRVEVDQATDACVNEPLPAPESALPGVYVDPPAADTLWFKVL |
Ga0233392_10277211 | 3300024241 | Deep Subsurface Sediment | DEVDQATDACVNDPLPAPQTALPGVYVHPAAAERLWFRML |
Ga0179589_101017002 | 3300024288 | Vadose Zone Soil | DQATDACANEPLPAPESALPGVYVDPPAADQLWFKVL |
Ga0209640_113695502 | 3300025324 | Soil | DQATDACVNDPLPAPQTALPGVYAHPAAAERLWFRML |
Ga0207662_111744962 | 3300025918 | Switchgrass Rhizosphere | LSADLVSEADLKDIDERVRVEVDQATDACVDEPLPSADTALTGVQVDPPAADQLWFKAL |
Ga0207652_113510551 | 3300025921 | Corn Rhizosphere | KDIDERVRVEVDQATDACVDEPLPAAESALPGVYVDPPAADKLWFKTL |
Ga0207648_103755123 | 3300026089 | Miscanthus Rhizosphere | TQRILSTDLVSEADLKDIDERVRVEVDQATDACVDEPLPSADTALTGVQVDPPAADQLWFKAL |
Ga0209469_11059583 | 3300026307 | Soil | VDQATDACVDEPLPAPQTALGGVYADPADTEQLWFRLL |
Ga0209239_10902613 | 3300026310 | Grasslands Soil | ERDLSGVDERARAEIDEATDTSVDEPLPQGETALPGVYVNPPAADRLWFRGL |
Ga0209472_12036313 | 3300026323 | Soil | QHVRDEVDQATDACVDEPLPPPETALGGVYADPADTEKLWFKLL |
Ga0209470_13717901 | 3300026324 | Soil | TQRVLSADLAHEGDLKDIDDRVRVEVDQATDACVDEPLPAAETALPGVYVEPPAADKLWFKAL |
Ga0209158_11450171 | 3300026333 | Soil | DIDERVRAGVDAATDACVDEPAPEPESALPAVYASPATAERLWFRGL |
Ga0209158_12495772 | 3300026333 | Soil | DLVGESHLKDIDDRVRDEVDQATDACVDEPLPEAETALPGVLVDPPVADTLWFKAL |
Ga0209377_12948291 | 3300026334 | Soil | KDIDDRVRDEVDQATDACVDEPLPEAETALPGVLVDPPVADTLWFKAL |
Ga0209376_10705231 | 3300026540 | Soil | DDRVRVEVDQATDACVNEPLPTPESALPGVYVDPPAADKLWFKVL |
Ga0209805_100349315 | 3300026542 | Soil | DERVRAEIDEATDACVDEPLPQGETALPGVYANPRAAERLWFRSL |
Ga0209161_101528121 | 3300026548 | Soil | DLTDIDAGVRAEIDQATDACVNEPLPPPESALPGVYASPAAAARLWFRSL |
Ga0209161_101989622 | 3300026548 | Soil | VDQAADACVDEPLPPAESALPGVYVDPPSADKLWFKAL |
Ga0209590_103726861 | 3300027882 | Vadose Zone Soil | DEVDQATDASVDEPLPEAETALPGVFVDPPVADKLWFKAL |
Ga0307282_101836291 | 3300028784 | Soil | EIDQATDACVNEPLPEAETALPGVYVDPPAADKLWFKAI |
Ga0307308_100779211 | 3300028884 | Soil | EVDQATDACVNEPLPTPETALPGVYVDPPAADKLWFKVL |
Ga0308194_100215881 | 3300031421 | Soil | EGDLKDIDDRVRVEVDQATDACVNEPLPTPETALPGVYVDPPAADKLWFKVL |
Ga0247727_100947231 | 3300031576 | Biofilm | DEVDLATDACVNEPLPAPESALDGVYASPRAAERLWFRAPVA |
Ga0247727_101650203 | 3300031576 | Biofilm | QATDACVDEPLPEGETALPGVYVDPPAADRLWFKAL |
Ga0307472_1002351561 | 3300032205 | Hardwood Forest Soil | LTGIDDRVRVEVDQATDACVDEPLPAAETALPGVYVDPPAADQLWFKAL |
Ga0214472_103226601 | 3300033407 | Soil | LQEQGMAAPDDLHDIDDRIRVEVDQATDACVDEPLPEGESALPDVYVDPPAADKLWFRTL |
⦗Top⦘ |