Metagenome Family F081940

Overview

Basic Information

• Family ID: F081940
• Family Type: Metagenome
• Number of Sequences: 114
• Average Sequence Length: 40 residues
• Representative Sequence: LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLN
• Number of Associated Samples: 19
• Number of Associated Scaffolds: 114

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.88 %
• % of genes near scaffold ends (potentially truncated): 21.93 %
• % of genes from short scaffolds (< 2000 bps): 41.23 %
• Associated GOLD sequencing projects: 19
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (54.386 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (61.404 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (77.193 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 56.52%
  β-sheet: 0.00%
  Coil/Unstructured: 43.48%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 114 Family Scaffolds
PF00078	RVT_1	1.75
PF03732	Retrotrans_gag	1.75
PF03405	FA_desaturase_2	0.88
PF09735	Nckap1	0.88
PF00875	DNA_photolyase	0.88
PF04618	HD-ZIP_N	0.88
PF14223	Retrotran_gag_2	0.88
PF13650	Asp_protease_2	0.88
PF05699	Dimer_Tnp_hAT	0.88
PF01657	Stress-antifung	0.88
PF02866	Ldh_1_C	0.88
PF00067	p450	0.88
PF13963	Transpos_assoc	0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 114 Family Scaffolds
COG0039	Malate/lactate dehydrogenase	Energy production and conversion [C]	0.88
COG0415	Deoxyribodipyrimidine photolyase	Replication, recombination and repair [L]	0.88
COG2124	Cytochrome P450	Defense mechanisms [V]	0.88

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
All Organisms	root	All Organisms	45.61 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
cellular organisms	root	All Organisms → cellular organisms	45.61 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	43.86 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.75 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	43.86 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.88 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	43.86 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.88 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	43.86 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.88 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	43.86 %
Sphingobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia	0.88 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	36.84 %
Sphingobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales	0.88 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	36.84 %
Sphingobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae	0.88 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	36.84 %
unclassified Sphingobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae	0.88 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	36.84 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	35.09 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	34.21 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	34.21 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	34.21 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	30.70 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.39 %
Populus davidiana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	8.77 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	5.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3.51 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	0.88 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.88 %
Populus deltoides	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	0.88 %
Sphingobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	0.88 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2035918001|WWPM1086_GHCZ7500_g1	Not Available	700
3300028786|Ga0307517_10001210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	43383
3300028786|Ga0307517_10008082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	15161
3300028786|Ga0307517_10014568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	10549
3300028786|Ga0307517_10023725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7606
3300028786|Ga0307517_10043114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4814
3300028786|Ga0307517_10054702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	3938
3300028786|Ga0307517_10058207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	3728
3300028786|Ga0307517_10144444	Not Available	1656
3300028786|Ga0307517_10350203	Not Available	802
3300028786|Ga0307517_10500523	Not Available	618
3300028786|Ga0307517_10516161	Not Available	604
3300028786|Ga0307517_10582012	Not Available	554
3300028786|Ga0307517_10622514	Not Available	528
3300028794|Ga0307515_10010769	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	17453
3300028794|Ga0307515_10018229	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12732
3300028794|Ga0307515_10020117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11939
3300028794|Ga0307515_10036228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7989
3300028794|Ga0307515_10061190	Not Available	5348
3300028794|Ga0307515_10084399	Not Available	4079
3300028794|Ga0307515_10093609	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	3723
3300028794|Ga0307515_10103404	Not Available	3414
3300028794|Ga0307515_10107796	Not Available	3288
3300028794|Ga0307515_10175340	Not Available	2117
3300028794|Ga0307515_10343111	Not Available	1144
3300028794|Ga0307515_10486413	Not Available	846
3300030521|Ga0307511_10100188	Not Available	1907
3300030522|Ga0307512_10023075	Not Available	5566
3300030522|Ga0307512_10378712	Not Available	606
3300031456|Ga0307513_10022430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	7423
3300031456|Ga0307513_10062163	Not Available	3948
3300031456|Ga0307513_10084436	Not Available	3261
3300031456|Ga0307513_10100367	Not Available	2920
3300031456|Ga0307513_10195142	Not Available	1871
3300031456|Ga0307513_10219776	Not Available	1722
3300031456|Ga0307513_10246014	Not Available	1589
3300031456|Ga0307513_10662541	Not Available	750
3300031456|Ga0307513_10672674	Not Available	741
3300031456|Ga0307513_10764680	Not Available	671
3300031456|Ga0307513_10795396	Not Available	651
3300031507|Ga0307509_10003323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	24604
3300031507|Ga0307509_10057256	Not Available	4133
3300031507|Ga0307509_10060657	Not Available	3996
3300031507|Ga0307509_10157195	Not Available	2177
3300031507|Ga0307509_10196617	Not Available	1859
3300031507|Ga0307509_10298375	Not Available	1361
3300031507|Ga0307509_10709037	Not Available	672
3300031507|Ga0307509_10916270	Not Available	541
3300031616|Ga0307508_10055320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	3515
3300031616|Ga0307508_10203903	Not Available	1578
3300031616|Ga0307508_10279848	Not Available	1261
3300031616|Ga0307508_10336716	Not Available	1100
3300031616|Ga0307508_10375034	Not Available	1013
3300031616|Ga0307508_10416975	Not Available	934
3300031616|Ga0307508_10733998	Not Available	599
3300031649|Ga0307514_10392062	Not Available	714
3300031649|Ga0307514_10491178	Not Available	587
3300031730|Ga0307516_10005297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	15521
3300031730|Ga0307516_10327598	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → unclassified Sphingobacteriaceae → Sphingobacteriaceae bacterium	1201
3300031730|Ga0307516_10412600	Not Available	1008
3300031730|Ga0307516_10538929	Not Available	821
3300031730|Ga0307516_10691380	Not Available	676
3300031730|Ga0307516_10865299	Not Available	568
3300031838|Ga0307518_10091330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2190
3300031838|Ga0307518_10215435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	1259
3300031838|Ga0307518_10464081	Not Available	670
3300032354|Ga0325403_1001113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	21737
3300032354|Ga0325403_1003154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	14926
3300032354|Ga0325403_1003953	Not Available	13679
3300032354|Ga0325403_1004868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	12563
3300032354|Ga0325403_1006616	Not Available	11046
3300032354|Ga0325403_1008628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides	9738
3300032354|Ga0325403_1009975	Not Available	9057
3300032354|Ga0325403_1011259	Not Available	8490
3300032354|Ga0325403_1015175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7199
3300032354|Ga0325403_1016827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	6769
3300032354|Ga0325403_1018132	All Organisms → cellular organisms → Bacteria	6470
3300032354|Ga0325403_1019649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6149
3300032354|Ga0325403_1023929	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	5394
3300032354|Ga0325403_1027534	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4870
3300032354|Ga0325403_1031449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	4416
3300032354|Ga0325403_1032703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	4282
3300032354|Ga0325403_1050973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2867
3300032354|Ga0325403_1053123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	2747
3300032354|Ga0325403_1076310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	1778
3300032355|Ga0325401_1002041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	17629
3300032355|Ga0325401_1003090	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	15103
3300032355|Ga0325401_1014336	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	7578
3300032355|Ga0325401_1034218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4348
3300032355|Ga0325401_1089421	Not Available	1793
3300032355|Ga0325401_1091189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	1753
3300032374|Ga0325400_1009901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	9116
3300032374|Ga0325400_1142320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	1305
3300032389|Ga0325405_1001671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	22641
3300032389|Ga0325405_1009711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	9385
3300032389|Ga0325405_1011808	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	8370
3300032389|Ga0325405_1066754	Not Available	1702
3300032390|Ga0325404_1003954	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	15795
3300032735|Ga0325410_1000599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	37935
3300032735|Ga0325410_1017669	Not Available	6896
3300033180|Ga0307510_10124373	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2273
3300033180|Ga0307510_10129177	Not Available	2206
3300033180|Ga0307510_10455953	Not Available	719
3300033180|Ga0307510_10525487	Not Available	627
3300033180|Ga0307510_10598996	Not Available	553
3300034389|Ga0325419_000990	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	31221
3300034389|Ga0325419_002751	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19827
3300034389|Ga0325419_010873	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	9381
3300034389|Ga0325419_022820	Not Available	5496
3300034389|Ga0325419_023160	Not Available	5434
3300034389|Ga0325419_042465	Not Available	2983
3300034389|Ga0325419_049286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus davidiana	2483
3300034389|Ga0325419_067118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	1577
3300034389|Ga0325419_095049	Not Available	893

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.12%
Engineered	Engineered	0.88%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.12%
Wastewater	Engineered → Wastewater	0.88%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	61.40%
Wood	Host-Associated → Plants → Wood	29.82%
Phylloplane	Host-Associated → Plants → Phylloplane	7.89%
Nutrient Removal	Engineered → Wastewater → Nutrient Removal	0.88%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	61.40%
Unclassified	Host-Associated → Plants → Wood → Unclassified	29.82%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	7.89%
Dissolved Organics (Aerobic)	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic)	0.88%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	61.40%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	29.82%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	7.89%
Activated Sludge	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge	0.88%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	61.40%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	29.82%
Leaf	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf	7.89%
Wastewater Plasmid Pools	Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools	0.88%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2035918001	Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler)	Engineered
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032390	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1	Host-Associated
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated
3300034389	Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
WWPMV_30620	2035918001	Wastewater Plasmid Pools	LIEIRGQIAKKLKFWGQLGFKLIKFAAKDQYAKGAKL
Ga0307517_100012102	3300028786	Ectomycorrhiza	LIKIRGQIARKLKFWGQLGAGLKKFGAKDQSAKGATIEGLN
Ga0307517_100080827	3300028786	Ectomycorrhiza	LIEIRGKIARKLKFLGQLGVKLTKFTVNDQSAKGARGLN
Ga0307517_100145683	3300028786	Ectomycorrhiza	LIGIKGQIARKLKFWGQLGAKLKKFTDKDQSAKGAKIEELN
Ga0307517_100237254	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFSGPLGVELTKFAAKDVSVKGAKL
Ga0307517_100431142	3300028786	Ectomycorrhiza	LFEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIKGLN
Ga0307517_100547027	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0307517_100582071	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKDAKIKGLN
Ga0307517_101444441	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKFAAKDQSAKGAKIEGLK
Ga0307517_103502031	3300028786	Ectomycorrhiza	LIEIKGQLARKLKFWGQLGAGLKKFVVKDQYAKGATIEELN
Ga0307517_105005231	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKFAANDQSAKGAKIEGLK
Ga0307517_105161611	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSEKGAKIKGLN
Ga0307517_105820121	3300028786	Ectomycorrhiza	LVEIRGQIAIKLKFWGQLEAKLKKLAARGQSAKGAKMKGLN
Ga0307517_106225141	3300028786	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAGLKKFATKDQSAKGATIEGLN
Ga0307515_100107693	3300028794	Ectomycorrhiza	LIEIRGPIARTLKFWGQLGVKLKKLTAKDHSAKGENIWGLN
Ga0307515_100182291	3300028794	Ectomycorrhiza	LIEIRGQTARKLKFWGQLGVKLKKLIAKDISVKGAKIKGLN
Ga0307515_1002011710	3300028794	Ectomycorrhiza	LIEIRGPIARKLKFWDQLGAGLKKFAPKDHSTKGATIEGLN
Ga0307515_100362282	3300028794	Ectomycorrhiza	LIEIRDKIARKLKFLGQLGVKLTKFAANDQSAKGARGLN
Ga0307515_100611902	3300028794	Ectomycorrhiza	LIEIRGKIARKLKFWGQLRAKLKKFAARDQSAKGAKI
Ga0307515_100843991	3300028794	Ectomycorrhiza	IEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKGAKIKGLN
Ga0307515_100936094	3300028794	Ectomycorrhiza	LINIRGQIARKLKFWGQLGAGLKKFGAKDQSAKGATIEGLN
Ga0307515_101034041	3300028794	Ectomycorrhiza	FLPSQLIEIKDKIARKLKFWGQLGDKLKIFVAKDQSAKDVELQGLN
Ga0307515_101077962	3300028794	Ectomycorrhiza	LIEIRGQIARKLKFWGQLEAKLKKSEAKDQSAKGGKLWGFN
Ga0307515_101753402	3300028794	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKMTAKDDSVKGAKIKGLN
Ga0307515_103431112	3300028794	Ectomycorrhiza	LNGNKIFYQVLIEIRDQIARKLKFWGQLGAGLKKFAAKDQSAKGTTIEGFN
Ga0307515_104864131	3300028794	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLTDFAAKDQSAKGAKIGGLN
Ga0307511_101001881	3300030521	Ectomycorrhiza	LIEIRGKIARKLKFWGQLGAKLKKFAAKDQSAKGAKIEGLK
Ga0307512_100230755	3300030522	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKGAKIKG
Ga0307512_103787121	3300030522	Ectomycorrhiza	LIGIKGQIARKLKFWGQLGAKVKKFTDKDQSAKGAKIEELN
Ga0307513_1002243011	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLEAKLKKFAAKDQSAMAPKLRGLIDKKRG
Ga0307513_100621631	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKFTAKDQSAKGAGL
Ga0307513_100844362	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAGLKKFAANDQSAKGATIEGLN
Ga0307513_101003671	3300031456	Ectomycorrhiza	LIEIRGQIARKLEFMGQLGVKLKKFADKDHFVKGGRLWDLIG
Ga0307513_101951421	3300031456	Ectomycorrhiza	QIARKLKFWGQLGVKLTKSKAKDQTARGAKLQGPN
Ga0307513_102197761	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKMTAKDVSVKGAKIKGLN
Ga0307513_102460141	3300031456	Ectomycorrhiza	IEIRGQIARKLKFWGQLGVKLKKLTAEDVSVKGTKL
Ga0307513_106625411	3300031456	Ectomycorrhiza	GIRGKIARKFKFWGQLGVKSTKFASRDQSARGATL
Ga0307513_106726741	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKFAARDQFAKGAGL
Ga0307513_107646801	3300031456	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKFAANDQYAKGAKIEGLN
Ga0307513_107953962	3300031456	Ectomycorrhiza	LPSYLIEIRGQIARKLKFWGQLGVKLKKFAARDQFAKGAGL
Ga0307509_100033235	3300031507	Ectomycorrhiza	LIEIRGQIARKLKFWGQLAAKLKKFAANNQSAKGAKIEELN
Ga0307509_100572561	3300031507	Ectomycorrhiza	LIEIRGQIGRKLKFWGQLGAKLKKFAAKDQSAKGAALWGLN
Ga0307509_100606573	3300031507	Ectomycorrhiza	EIRGQITRKLKFWGQLGVKLTKFTAKDQSVKWAKIEGLN
Ga0307509_101571954	3300031507	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKMIAKDVSVKDAKIKGLN
Ga0307509_101966171	3300031507	Ectomycorrhiza	LIEIKGQIARKLKFWGQLEAKLKKFAARDQSAKGAKIKGLN
Ga0307509_102983752	3300031507	Ectomycorrhiza	LIEIRGPIARKLKFWGQLGAGLKKFAPKNHSTKGATIEGLN
Ga0307509_107090372	3300031507	Ectomycorrhiza	RGKITRKLKFWSQLGAKLKKFATKDQSARGATIKGLN
Ga0307509_109162701	3300031507	Ectomycorrhiza	IEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0307508_100553202	3300031616	Ectomycorrhiza	LIEIRGQIARKLKFLGQLGVKLTKFTDNDHSATGAKL
Ga0307508_102039031	3300031616	Ectomycorrhiza	LIEIRGQIARKLKFLGQLGAKLKKFAAKDQSAKGAKIEGLK
Ga0307508_102798481	3300031616	Ectomycorrhiza	LIEIRDQIARKLKFWGQLGAGLKKFAAKDQSAKGTTIEGFN
Ga0307508_103367161	3300031616	Ectomycorrhiza	EIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0307508_103750341	3300031616	Ectomycorrhiza	EIRGQIARKLKFWGQLGVKLTKSKAKGQSAKGAKL
Ga0307508_104169751	3300031616	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGAKLKKLAARGQSAKGAKLRGLIEKHRG
Ga0307508_107339982	3300031616	Ectomycorrhiza	LIKIRGQIARTLKFWGQLGAGLKKFGAKDQSAKGATIEGLN
Ga0307514_103920621	3300031649	Ectomycorrhiza	LIEIRGQIARKLKFLGQLGVKLKKLTAKDVSVKGAKIKGLNXQNPGVK
Ga0307514_104911781	3300031649	Ectomycorrhiza	LIEIRGQIARKLKFWGQLAAKLKKFAANNQSAKGAKIKELN
Ga0307516_1000529714	3300031730	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDVSVKGPNFRGLIDKNWG
Ga0307516_103275983	3300031730	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLEKLTAKDVSVKGAKIKGLN
Ga0307516_104126001	3300031730	Ectomycorrhiza	LIEIKGQIARKLKFWGQLGAKLKKSEAKDQSAKGGKLW
Ga0307516_105389291	3300031730	Ectomycorrhiza	IEIRRQIARKLKFWGQLGVKLKKLIAMDQSAKGVRL
Ga0307516_106913802	3300031730	Ectomycorrhiza	LIEIRDKIARKLKFLGQLGVKLTKFAANDQSAKGAR
Ga0307516_108652992	3300031730	Ectomycorrhiza	LIEIRGKIAIKLKFRGQLGAKLKKFAAKDQSAKGAKI
Ga0307518_100913301	3300031838	Ectomycorrhiza	LIEIRGQIARKLKFWGQLGVKLKKLTAKDQSAKGA
Ga0307518_102154353	3300031838	Ectomycorrhiza	PSYLIEIRGQIARKLKFWGQLGVKLKKFAARDQFAKGAGL
Ga0307518_104640811	3300031838	Ectomycorrhiza	IRGKITRKLKFWGQLRVILKKFTVNDQSVKSVKQWGLN
Ga0325403_10011137	3300032354	Xylem	LIKIKDKIARKSKFWSQLGVKLKKFAAKDQSAKGAELWGPN
Ga0325403_10031545	3300032354	Xylem	LIEIRSQIARKLKFWGQLGAGLKKFAAKDQSAKDATIEGLN
Ga0325403_10039537	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFVAKDQSAKGATIEGLN
Ga0325403_10048687	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLN
Ga0325403_10066162	3300032354	Xylem	LIEIRGQIARKLKFLDQLGVKLIKFAAKDQTAKGATIGGLN
Ga0325403_10086282	3300032354	Xylem	LIEIGGQIARILKFWGQFGARLKKFAAKDQSAKGATIEGLN
Ga0325403_10099752	3300032354	Xylem	LIEIRGQIARKLKFWGQLGTGLKKFAAKDQSAKGATIEGLN
Ga0325403_10112591	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGTTIEGLN
Ga0325403_10151754	3300032354	Xylem	LIEIRGQIARKLNFWGQLGVKLKKFAARDQFAKGVGL
Ga0325403_10168273	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGAIIEGLN
Ga0325403_10181322	3300032354	Xylem	LIEIRGQIARKLKFWGQLGTGLKKFAAKDQSAKGTTIEGLN
Ga0325403_10196494	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAKLKKFTAKDQSAKAPKLRGLIDKNRG
Ga0325403_10239291	3300032354	Xylem	LIEIKGQIARKLKFWGQLGAGLKKFATKDQSAKSATIEGLN
Ga0325403_10275342	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFVAKDQSAKGTTIEGLN
Ga0325403_10314491	3300032354	Xylem	LIEIKGQIARKLKFLGQLGAGLKKFAAKDQSAKSATIEGLN
Ga0325403_10327035	3300032354	Xylem	LIEIRGQIARKLKFWGQLRAGLKKFAAKDQSAKNATIEGLN
Ga0325403_10509732	3300032354	Xylem	IWGQIARKLNFWGQLGAKLNKSEAKDHSAIGGKLWGFN
Ga0325403_10531232	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIKGLN
Ga0325403_10763103	3300032354	Xylem	LIEIRGQIARKLKFWGQLGAKLKKFAANDQSAKGATIKGLN
Ga0325401_10020419	3300032355	Xylem	LIEIRGQIARKLKFWGQLGVGLKKFVAKDQSAKGTTIEGLN
Ga0325401_100309021	3300032355	Xylem	LIKIKDKIARKSKFWSQLGVKLKKFAAKDQSAKGVELWGPN
Ga0325401_10143363	3300032355	Xylem	LIEIRGPIARKLKFWGQLGARLKKFAAKDQSAKDTTIEGLN
Ga0325401_10342182	3300032355	Xylem	LIEIRGHIARQLKFWGQLGARLKKFAAKDQSAKGTTIEGLN
Ga0325401_10894211	3300032355	Xylem	IEIRGKITRKSKLWYQLRVKLKKFTINNQSAKCTRL
Ga0325401_10911895	3300032355	Xylem	LIEIRGQIARKLKFWGQLGVGLKKFAAKDQSAKGTIIEGLN
Ga0325400_10099017	3300032374	Xylem	LIEIRGPITRKLKFWGQLGVKLKKLTAKDQSAKGAKI
Ga0325400_11423201	3300032374	Xylem	QIARKLNFWGQLGAKLNKSEAKDHSAIGGKLWGFN
Ga0325405_10016718	3300032389	Xylem	LIEIKGKIARKLKFWGQLGAKFKKFAANDQSAKSAKQ
Ga0325405_10097114	3300032389	Xylem	LIEIRGQIARKLKFWGQLRAALKKFAAKDQSAKDATIEGLN
Ga0325405_10118081	3300032389	Xylem	LIEIRGQIARKLKFWGQLGVKMTKFTAKDQSAKDAKIRGLN
Ga0325405_10667541	3300032389	Xylem	LIEIRCQIARKLKFLGQLGVKLVKFIAKDHSATGGKPWGLN
Ga0325404_10039543	3300032390	Xylem	LIEIRGQIARKLKFWGQLGVKLTKFAAKDQSAKGAKIGGFN
Ga0325410_10005993	3300032735	Xylem	LIEIKGQIARKLKFWGQLGAGLKKFATKDQSPKGTTIEGFN
Ga0325410_10176691	3300032735	Xylem	LIEIRGQIARKLKFLGQLGVKLIKFATKDQSAKGPKIGGLT
Ga0307510_101243731	3300033180	Ectomycorrhiza	EIRGQIAKTLKFWGQLGVKLKKLTAKDVSVKDAKL
Ga0307510_101291771	3300033180	Ectomycorrhiza	LIEIRGQITRKLKFWGQLEAKLKKFAAKDQSAKGAKIEGLK
Ga0307510_104559531	3300033180	Ectomycorrhiza	LIEIRGQIVRKLKFWGQLGVKLKKMTAKDVSVKGAKIKGLN
Ga0307510_105254871	3300033180	Ectomycorrhiza	EIRGQIARKLKFWGQLGVKLTKFAAKDQYAKSAKL
Ga0307510_105989962	3300033180	Ectomycorrhiza	LFEIRGQIARKLKFWGQLGAGLKKFAAKDQSAKGATIEGLD
Ga0325419_000990_25388_25513	3300034389	Leaf	LIEIRGQIARKLKFWGQLGVKLTKFTAKDQSAKGAKIRGLN
Ga0325419_002751_3020_3145	3300034389	Leaf	LIEIGVQIARKLKFWGQLRAGLKKFAAKDQSAKCATIEGLN
Ga0325419_010873_4554_4679	3300034389	Leaf	LIEIRGQIARKLKFLGQLGVKLTKFAANDQYAKGAKIGGLN
Ga0325419_022820_4319_4444	3300034389	Leaf	LIEIRGQIARKLKFWGQLGVGLKKFTAKDQFAKGTTIEGLN
Ga0325419_023160_4257_4382	3300034389	Leaf	LIEIRGQIARKLKFWGQLGAGLKKFTAKDQFAKGTTIEGLN
Ga0325419_042465_84_197	3300034389	Leaf	LIEISGQIARKLKFLGQLGAKLKKFTAKDQSAKGIKL
Ga0325419_049286_68_193	3300034389	Leaf	LIEIRGQIARKLKFWGQLGARLKKFIAKDQSAKGTTIEGLN
Ga0325419_067118_544_657	3300034389	Leaf	LIEISGQIARKLKFFGQLGAKLKKFTAKDQSAKGTKL
Ga0325419_095049_41_154	3300034389	Leaf	LIEIGGQIARKLKFWGQLGVKLKKLIAKDQSAKGAKI