NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081732

Metagenome / Metatranscriptome Family F081732

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081732
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 47 residues
Representative Sequence GEKITTGGLEENKLKKLKGLRFTLPALSIVEAKQMGLGATTCCR
Number of Associated Samples 103
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.00 %
% of genes near scaffold ends (potentially truncated) 83.33 %
% of genes from short scaffolds (< 2000 bps) 81.58 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (58.772 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(9.735 % of family members)
Environment Ontology (ENVO) Unclassified
(35.965 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.228 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF01557FAA_hydrolase 31.58
PF10988DUF2807 14.04
PF13366PDDEXK_3 8.77
PF0563523S_rRNA_IVP 5.26
PF01613Flavin_Reduct 3.51
PF04209HgmA_C 2.63
PF02927CelD_N 1.75
PF12840HTH_20 1.75
PF02469Fasciclin 0.88
PF12784PDDEXK_2 0.88
PF17189Glyco_hydro_30C 0.88
PF13419HAD_2 0.88
PF02800Gp_dh_C 0.88
PF09674DUF2400 0.88
PF01180DHO_dh 0.88
PF01479S4 0.88
PF04116FA_hydroxylase 0.88
PF00425Chorismate_bind 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 3.51
COG3508Homogentisate 1,2-dioxygenaseSecondary metabolites biosynthesis, transport and catabolism [Q] 2.63
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.88
COG0057Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenaseCarbohydrate transport and metabolism [G] 0.88
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.88
COG0167Dihydroorotate dehydrogenaseNucleotide transport and metabolism [F] 0.88
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.88
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.88
COG2335Uncaracterized surface protein containing fasciclin (FAS1) repeatsGeneral function prediction only [R] 0.88
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.77 %
UnclassifiedrootN/A41.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig57682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes680Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10178379Not Available512Open in IMG/M
3300002077|JGI24744J21845_10098556Not Available539Open in IMG/M
3300002128|JGI24036J26619_10036245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes945Open in IMG/M
3300004054|Ga0063232_10045507Not Available1141Open in IMG/M
3300004779|Ga0062380_10000992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5788Open in IMG/M
3300005260|Ga0074072_1155430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes533Open in IMG/M
3300005293|Ga0065715_10168642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1565Open in IMG/M
3300005335|Ga0070666_10447653All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes932Open in IMG/M
3300005338|Ga0068868_102156176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes530Open in IMG/M
3300005441|Ga0070700_101236392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes625Open in IMG/M
3300005526|Ga0073909_10463634All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes607Open in IMG/M
3300005543|Ga0070672_100715413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes877Open in IMG/M
3300005543|Ga0070672_101348838Not Available637Open in IMG/M
3300005563|Ga0068855_100116387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3064Open in IMG/M
3300005840|Ga0068870_10391622Not Available902Open in IMG/M
3300006169|Ga0082029_1604824All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes520Open in IMG/M
3300006358|Ga0068871_100780645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes880Open in IMG/M
3300006791|Ga0066653_10065610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1556Open in IMG/M
3300006844|Ga0075428_102283811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes557Open in IMG/M
3300006894|Ga0079215_10319955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes869Open in IMG/M
3300006918|Ga0079216_11046064Not Available636Open in IMG/M
3300007004|Ga0079218_10728278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes937Open in IMG/M
3300007004|Ga0079218_12963686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes571Open in IMG/M
3300007248|Ga0075168_1007086Not Available645Open in IMG/M
3300007651|Ga0102900_1148955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium516Open in IMG/M
3300009093|Ga0105240_11447469All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes721Open in IMG/M
3300009093|Ga0105240_11796966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae639Open in IMG/M
3300009094|Ga0111539_11973457Not Available677Open in IMG/M
3300009095|Ga0079224_100654275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1507Open in IMG/M
3300009164|Ga0114975_10373191Not Available781Open in IMG/M
3300009184|Ga0114976_10650944Not Available531Open in IMG/M
3300010160|Ga0114967_10129613Not Available1425Open in IMG/M
3300010352|Ga0116247_11257252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes529Open in IMG/M
3300010357|Ga0116249_11507981Not Available597Open in IMG/M
3300010371|Ga0134125_10207023All Organisms → cellular organisms → Bacteria2183Open in IMG/M
3300010403|Ga0134123_13649156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes500Open in IMG/M
3300011119|Ga0105246_11626424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes611Open in IMG/M
3300011264|Ga0151623_1003712Not Available1347Open in IMG/M
3300011437|Ga0137429_1118763All Organisms → cellular organisms → Bacteria → FCB group811Open in IMG/M
3300011440|Ga0137433_1237661All Organisms → cellular organisms → Bacteria → FCB group595Open in IMG/M
3300011442|Ga0137437_1203169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes688Open in IMG/M
3300012018|Ga0119867_1189467Not Available545Open in IMG/M
3300012094|Ga0136638_10180495Not Available957Open in IMG/M
3300012361|Ga0137360_11348883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes615Open in IMG/M
3300012533|Ga0138256_10120212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Sediminibacterium2467Open in IMG/M
3300012796|Ga0160498_102473Not Available1604Open in IMG/M
3300012892|Ga0157294_10013984All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1459Open in IMG/M
3300012903|Ga0157289_10432978All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012907|Ga0157283_10324421All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes544Open in IMG/M
3300012956|Ga0154020_10904416All Organisms → cellular organisms → Bacteria → FCB group688Open in IMG/M
3300013097|Ga0136639_10321549All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300013105|Ga0157369_11654400Not Available651Open in IMG/M
3300013296|Ga0157374_10873979Not Available916Open in IMG/M
3300013297|Ga0157378_12710759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes548Open in IMG/M
3300013307|Ga0157372_10184004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2419Open in IMG/M
3300013307|Ga0157372_11071949Not Available932Open in IMG/M
3300013307|Ga0157372_12117960Not Available646Open in IMG/M
3300013308|Ga0157375_13548499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes519Open in IMG/M
3300014326|Ga0157380_12917364Not Available544Open in IMG/M
3300015189|Ga0167667_1048614Not Available1014Open in IMG/M
3300015371|Ga0132258_11764902Not Available1560Open in IMG/M
3300015373|Ga0132257_100689610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1268Open in IMG/M
3300015373|Ga0132257_100903861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1107Open in IMG/M
3300015373|Ga0132257_102296075All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300015374|Ga0132255_103037265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes716Open in IMG/M
3300017440|Ga0182214_1083302Not Available669Open in IMG/M
3300017695|Ga0180121_10260182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes653Open in IMG/M
3300017789|Ga0136617_10641439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes829Open in IMG/M
3300017824|Ga0181552_10302446All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300018063|Ga0184637_10520338All Organisms → cellular organisms → Bacteria → FCB group688Open in IMG/M
3300018476|Ga0190274_10548446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1169Open in IMG/M
3300018476|Ga0190274_13609628Not Available523Open in IMG/M
3300018476|Ga0190274_13792187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes511Open in IMG/M
3300018920|Ga0190273_11520120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes593Open in IMG/M
3300019361|Ga0173482_10370110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes656Open in IMG/M
3300019362|Ga0173479_10162842Not Available904Open in IMG/M
3300025847|Ga0209607_1110013Not Available1169Open in IMG/M
3300025903|Ga0207680_10429970All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes936Open in IMG/M
3300025908|Ga0207643_10411676Not Available856Open in IMG/M
3300025961|Ga0207712_10152099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1789Open in IMG/M
3300025972|Ga0207668_10834771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes817Open in IMG/M
3300026041|Ga0207639_10999839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Panacibacter → Panacibacter ginsenosidivorans783Open in IMG/M
3300026088|Ga0207641_11694841Not Available634Open in IMG/M
3300026089|Ga0207648_10000820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea35151Open in IMG/M
3300026089|Ga0207648_10948978All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300026095|Ga0207676_11677682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes634Open in IMG/M
3300026142|Ga0207698_11834650All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300026306|Ga0209468_1056775All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1321Open in IMG/M
3300027831|Ga0209797_10009811All Organisms → cellular organisms → Bacteria → FCB group4487Open in IMG/M
3300027993|Ga0247749_1041836All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes545Open in IMG/M
3300029951|Ga0311371_11479569Not Available758Open in IMG/M
3300030606|Ga0299906_10731527All Organisms → cellular organisms → Bacteria → FCB group740Open in IMG/M
3300031086|Ga0074002_10029700All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300031852|Ga0307410_11953320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes523Open in IMG/M
3300031995|Ga0307409_101550274Not Available690Open in IMG/M
3300034009|Ga0334944_058991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes729Open in IMG/M
3300034019|Ga0334998_0294598Not Available966Open in IMG/M
3300034160|Ga0370510_0139737Not Available742Open in IMG/M
3300034175|Ga0334939_0111789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes868Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.31%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.42%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.54%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.54%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.54%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.54%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.65%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge2.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.77%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.77%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.77%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.89%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.89%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.89%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.89%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.89%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere0.89%
Leaf SurfaceHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Leaf Surface0.89%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.89%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.89%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.89%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.89%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300002077Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005260Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007248Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 D RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011264Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012018Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)EngineeredOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012796Enriched soil microbial communities from UW Madison campus, WI, USA - DID2878_E24_Xylan MGEnvironmentalOpen in IMG/M
3300012844Enriched soil microbial communities from UW Madison campus, WI, USA - HID1975M_E11 MGHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300013097Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ859 (21.06)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015024Arctic sediment microbial communities from supraglacial cryoconite, Rabots glacier, Tarfala, Sweden (Sample Rb cryoconite)EnvironmentalOpen in IMG/M
3300015189Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025847Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031086Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031372Leaf surface microbial communities from wheat plants in UC Gill Tract Community Farm, Albany, California, United States - DLSL W.R1 (v2)Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300034009Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMSEnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034160Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18EnvironmentalOpen in IMG/M
3300034175Biocrust microbial communities from Mojave Desert, California, United States - 35SMCEnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_110012102124908045SoilLTLLEGEKITIGGFDENKLKKLKGLRFTFPSLSIVEAKQTGLGATTCCR
KGI_S1_ANT02_95mDRAFT_1017837913300000136MarineFVVLFKPLRDGENINVGGFEPKILKKLKGLRFTWPSLSIVLAKAMGLGPIAESKSL*
NpDRAFT_1023521413300000929Freshwater And MarineHIGGFELNKLKKLNGLKFTFPALSMVEAKQMGLGAMAYCK*
JGI24744J21845_1009855623300002077Corn, Switchgrass And Miscanthus RhizosphereREGEKTAIGGLIEKRLKKLKGLRLILPFESIVLAKQIGRGAIACCR*
JGI24036J26619_1003624513300002128Corn, Switchgrass And Miscanthus RhizosphereTLREGENIRIGGLVENKLKKLNGLRLILPALSMVEAKQTGLGATTCCR*
Ga0063232_1004550723300004054Freshwater LakeTHIGGLELNKLKKLNGLKFTFPALSTVEAKQMGLGAMAYCK*
Ga0062380_1000099213300004779Wetland SedimentEGENITMGGLVENKLKKLKGLRFTLPALSMVDAKQIGLGAITCCR*
Ga0074072_115543023300005260SoilLTRRDGEKMTIGGFDENILKKLKGLRFTFPSLSMVDAKQMGLGPITCCK*
Ga0065715_1016864213300005293Miscanthus RhizosphereLEGEKMTIGGCIENKLKKLKGLRFTPPSLFIVEAKQIGLGPMICCK*
Ga0070666_1044765323300005335Switchgrass RhizosphereSRTLREGEKMIMGGWDEKRLKKLKGLRFTCPFLSTVLARQIGRGAIACCSQF*
Ga0068868_10215617623300005338Miscanthus RhizosphereLVVLFLTLLDGEKTTIGGLVEKRLKKLKGLRLTFPALSIVLAKQTGLGATTCCR*
Ga0070700_10123639213300005441Corn, Switchgrass And Miscanthus RhizosphereLVVLFLTLLDGEKTTIGGWVEKRLKKLKGLRLTFPALSIVLAKQTGLGATTCCR*
Ga0073909_1046363413300005526Surface SoilGLIEKRLKKLNGLRLMFPSLSIVLAKQTGRGAMAC*
Ga0070672_10071541323300005543Miscanthus RhizosphereLVEKRLKKLKGLRLTFPALSIVLAKQTGLGATTCCR*
Ga0070672_10134883823300005543Miscanthus RhizosphereLSLILLEGAKITMGGLDEKRLKKLKGLRFTFPAASIVLAKQIGLGAMAC*
Ga0068855_10011638713300005563Corn RhizosphereRDGEKTHIGGLVLTILKKLNGLRFTLPCLSTVEAKQMGRGAMAYCK*
Ga0068870_1039162213300005840Miscanthus RhizosphereEGEKTAIGGLIEKRLKKLKGLRLILPFESIVLAKQIGRGAIACCR*
Ga0082029_160482413300006169Termite NestEGENTTMGGLVEKRLKKLKGLRFTFPSLSIVEAKQMGRGATRCCR*
Ga0068871_10078064523300006358Miscanthus RhizosphereLSLTLRDGEKITIGGLEENKLKKLNGLRFMLPVLSIVEAKQTGLGATICCR*
Ga0066653_1006561033300006791SoilTFSNVCLVVLSLILLAGEKMTIGGLDENKLKKLKGVRFTFPSLSIVDAKQIGRGAITCWR
Ga0075428_10228381123300006844Populus RhizosphereLTGEKITIGGFEENILKKLNGLRLTFPSLSMVEAKQIGLGAMICWR*
Ga0079215_1031995513300006894Agricultural SoilRDGEKITIGGLEENKLKKLKGLRFILPALSIVEAKQTGLGATTCCR*
Ga0079216_1104606423300006918Agricultural SoilGLVEKRLKKLKGLRFTFPSLSMVLAKHIGLGAIACCR*
Ga0079218_1072827823300007004Agricultural SoilLLEGEKITIGGLEENKLKKLNGLRFTFPALSMVEAKQTGRGATTCCR*
Ga0079218_1296368613300007004Agricultural SoilTLLAGEKITTGGFEENMLKKLKGLRLTLPFLSMVLAKQTGLGAMTCWR*
Ga0075168_100708623300007248Wastewater EffluentVVLSLTLLAGENITTGGLEENRLKKLKGLRFTFPALSMVEAKQMGLGAIACCR
Ga0102915_112881513300007562EstuarineMLNKLKKLNGLKLIFPSASIVEAKHIGLGAIACCK*
Ga0102878_102609113300007624EstuarineIGGFELNKLKKLNGLKFTFPALSIVEAKQMGLGAIAYCK*
Ga0102876_118112013300007642EstuarineMLNKLKKLKGLRFTWPFKSIVEAKQIGLGAIAYCKYC
Ga0102900_114895523300007651EstuarineVVLSLTLQDGEKIQIGGFMLNKLKKLKGLKFTFPSKSIVDAKQIGL
Ga0102899_101923913300007706EstuarineQIGGFELNKLKKLNGLKFTFPALSMVEAKQMGLGAMAYCK*
Ga0105240_1144746913300009093Corn RhizosphereTLRDGEKITIGGLVENKLKKLNGLRFMFPALSIVDAKQTGLGATTCWR*
Ga0105240_1179696613300009093Corn RhizosphereDGEKTQTGGLVPNKLKKLNGLRFILPALSTVEAKQMGRGAMAYCR*
Ga0111539_1197345713300009094Populus RhizosphereMGGLDENKLKKLKGLRFTLPALSMVEAKQIGLGAITCCR*
Ga0079224_10065427513300009095Agricultural SoilDGENMTMGGLVEKRLKKLKGLRLTFPARSIVDAKHIGRGAITCCR*
Ga0114968_1000250213300009155Freshwater LakeKKLKGLKFTFPSKSIVDAKQIGLGAIAYCKYCCIS*
Ga0114975_1037319113300009164Freshwater LakeTSVTFCSVCLMKLSLTLCAGEKTTIGGLAENKLKKLYGLKFMLPSKSIVDAKQMGRGAMACCK*
Ga0114976_1065094413300009184Freshwater LakeTLLAGEKMKVTGFEPKMLKKLKGERFTSPLLSMVLAKQIGLGATEVSKAL*
Ga0105249_1270784223300009553Switchgrass RhizosphereEKRLKKLKGLRFTFPFLSIVEAKQTGLGATTCCK*
Ga0114967_1012961323300010160Freshwater LakeVVLFLNLLDGEKITIGGCIEKILKKLKGLRLTSPEASIVLAKAMGLGAMACCR*
Ga0116247_1125725213300010352Anaerobic Digestor SludgeMTMGGWEENILKKLNGLRFTLPALSIVEAKQMGLGAITCWR*
Ga0116249_1150798113300010357Anaerobic Digestor SludgeCLMVLSLTLLEAEKINIGGLAEKRLKKLKGLKFPCPSLSMVLAKQIGLGAIECWR*
Ga0134125_1020702343300010371Terrestrial SoilSLTLREGEKTQTAGLVLNKLKKLNGLRFMLPPLSMVDAKQTGRGAMAYWR*
Ga0134123_1364915623300010403Terrestrial SoilLSLTLRDGEKITIGGLEENKLKKLKGLRFMFPALSIVDAKQTGLGATTCCR*
Ga0105246_1162642423300011119Miscanthus RhizosphereMGGLEENKLKKLKGLRLTFPALSIVDAKQTGRGATTCCR*
Ga0151623_100371223300011264SedimentLSLTLLDGEKMTMGGLDENKLKKLKGLRFTFPSLSIVEAKQTGRGATICCR*
Ga0137429_111876323300011437SoilLLAGEKITTGGWEENKLKKLNGLRFTFPTLSIVEAKQIGRGAMICCR*
Ga0137433_123766123300011440SoilGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR*
Ga0137437_120316913300011442SoilCLVVLSLILLEGEKIAIGGLEENKLKKLKGLRLTLPALSIVDAKHTGLGATTCKR*
Ga0119867_118946713300012018Activated SludgeLLAGENIAIGGLLPKILKKLKGDKLGFPSASMVDAKHIGRGAIAPNK*
Ga0136638_1018049513300012094Polar Desert SandLVVLSLTLLEGEKIAIGGLILNKLKKLKGLKLTLPFKSIVLAKHTGLGAIACCK*
Ga0137360_1134888313300012361Vadose Zone SoilTFCNVCLVVLFLILLADEKITTGGLEENKLKKLKGLRFTLPALSTVDAKQMGLGATRCCR
Ga0138256_1012021233300012533Active SludgeEKTTIGGLDENRLKKLNGLKLILPASSMVLAKQIGLGAIAC*
Ga0160498_10247333300012796SoilLSLTLRAGEKIHIGGLVLNILKKLKGLRLMCPSVSMVEAKQMGLGAMAYCR*
Ga0160475_11943323300012844LLVTEKTHIGGFILTTLKKLNGLKLILPYLSIVDAKHIGRGAMAACK*
Ga0157294_1001398433300012892SoilNLLEGEKITIGGCIENKLKKLKGLRFTPPSLFIVEAKQIGLGPMICCK*
Ga0157289_1043297823300012903SoilVVLSLTLRAGEKITIGGLEENKLKKLKGLKFTFPALSTVEAKHMGRGPM
Ga0157283_1032442123300012907SoilEKITIGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR*
Ga0154020_1090441613300012956Active SludgeLLAGENITTGGLEENRLKKLKGLRFTFPALSMVAAKQIGLGAIACCR*
Ga0136639_1032154913300013097Polar Desert SandTIGGFDENKLKKLKGLRFSNPSLSIVEAKQTGRGAMACCR*
Ga0157369_1165440023300013105Corn RhizosphereSSVCLVVLSLTLREGEKISTGGVEENILKKLKGLRFIRPFLSMVLAKHTGRGATAYCR*
Ga0157374_1087397923300013296Miscanthus RhizosphereEGEKITMGGLEENKLKKLKGLKLIFPSLSMVEAKHIGLGAIACCRKFCTSVI*
Ga0157378_1271075913300013297Miscanthus RhizosphereSLNLRDGEKITIGGWVENKLKKLKGLRFTCPFLSMVEAKQTGLGAITCCR*
Ga0157372_1018400443300013307Corn RhizosphereGEKIAIGGLLVKKLKKLKGLRFTFPFKSIVDAKQMGRGAIA*
Ga0157372_1107194923300013307Corn RhizosphereMVVLFLTLLDGEKIAIGGLLVKKLKKLKGLRFTFPFKSIVDAKQMGRGAIA
Ga0157372_1211796013300013307Corn RhizosphereLVVLFLTLRDGEKITIGGLVENKLKKLNGLRFTFPAASIVEAKHMGRG
Ga0157375_1354849913300013308Miscanthus RhizosphereRLDGENIQIGGFVLNILKKLKGLKLIFPSKSIVDAKQIGRGAIAYCK*
Ga0157380_1291736413300014326Switchgrass RhizosphereGEKITMGGLIENKLKKLKGDRFMFPTLSIVDAKHMGRGAMACCRKF*
Ga0167669_109168133300015024Glacier Forefield SoilTTIGGLDEKRLKKLNGDKFTFPSLSIVDAKQIGRGAIAC*
Ga0167667_104861413300015189Glacier Forefield SoilLTLLAGENITTGGLLEKRLKKLKGDRFTFPALSIVDAKHIGRGATAC*
Ga0132258_1176490233300015371Arabidopsis RhizosphereRRTGENITIGGVVENKLKKLKGLKLTCPILSTVDAKHIGLGAMAC*
Ga0132257_10068961013300015373Arabidopsis RhizosphereTRLAGEKTTTGGRVENRLKKLNGLRFTFPSRSIVEAKQMGRGATTC*
Ga0132257_10090386113300015373Arabidopsis RhizosphereLSLNLLEGEKTTIGGWVENKLKKLKGLRFTWPFLSIVEAKQTGLGAIICCR*
Ga0132257_10229607523300015373Arabidopsis RhizosphereVELSLTLLDGEKITIGGLDENILKKLKGLRLTFPALSMVEAKQIGLGATMC*
Ga0132255_10081095213300015374Arabidopsis RhizosphereEKRLKKLNGLRFTFPLLSIVEAKQIGLGAIACCK*
Ga0132255_10303726523300015374Arabidopsis RhizosphereLLTGEKTTIGGLEENMLKKLNGLRLTLPSLSIVDAKQIGRGAITCCR*
Ga0182214_108330213300017440Switchgrass PhyllosphereLSLTRLDGEKTHIGGLVLNILKKLKGLKFTLPDLSIVEAKQIGRGAIAYCK
Ga0180121_1026018213300017695Polar Desert SandCLVVLSLILLEGEKITTGGFEENKLKKLKGLRFTLPALSIVDAKQIGLGAIACWR
Ga0136617_1064143923300017789Polar Desert SandLAGEKITIGGTEENILKKLKGLRFTCPFLSIVEAKQMGLGATTCCR
Ga0181552_1030244623300017824Salt MarshLLREGEKIKIGGLKLKILKKLNGLRFTFPWALIDVTKAIGRGATEEINS
Ga0184637_1052033813300018063Groundwater SedimentGEKITTGGLEENKLKKLKGLRFTLPALSIVEAKQMGLGATTCCR
Ga0190274_1054844633300018476SoilEKITTGGLEENMLKKLNGLRFTFPSLSIVEAKHIGLGAITCCR
Ga0190274_1360962813300018476SoilCLVVLSRNRRTGENITIGGVVENKLKKLKGLKLTSPFLSIVEAKHIGLGAMAC
Ga0190274_1379218713300018476SoilLFRTLLAGEKITIGGLEENILKKLKGLRFTLPAASMVEAKQTGRGPITCCR
Ga0190273_1152012013300018920SoilSLTLLAGEKMHSGGLVLNMLKKLNGLRLILPALSIVVAKQIGRGAMAY
Ga0173482_1037011013300019361SoilGGLEENKLKKLNGLRFILPALSMVEAKQTGLGATTCCR
Ga0173479_1016284223300019362SoilLTLLAGEKITIGGFDENKLKKLKGLRFTLPALSIVDAKQIGLGAITCCR
Ga0222622_1029773113300022756Groundwater SedimentGGFVENKLKKLNGLRFTSPFLLIVDAKQIGRGAITC
Ga0207656_1066758913300025321Corn RhizosphereGLDENMLKKLKGLKFTFPSLSIVDAKQIGRGAITCCK
Ga0209607_111001323300025847Anaerobic Digestor SludgeLVVLSLTLREGEKITTGGFDENRLKKLKGLRFTCPSLSIVDAKHIGLGAMICWR
Ga0207680_1042997023300025903Switchgrass RhizosphereFIELSRTLREGEKMIMGGWDEKRLKKLKGLRFTCPFLSTVLARQIGRGAIACCSQF
Ga0207643_1041167623300025908Miscanthus RhizospherePLREGEKTAIGGLIEKRLKKLKGLRLILPFESIVLAKQIGRGAIACCR
Ga0207712_1015209913300025961Switchgrass RhizosphereLILLTGEKITIGGFEENILKKLNGLRLTFPSLSMVEAKQIGLGAMICWR
Ga0207668_1083477113300025972Switchgrass RhizosphereTIGGLVEKRLKKLKGLRFTLPALSIVLAKQTGLGATTCCR
Ga0207639_1099983913300026041Corn RhizosphereLSLTLRDGEKITTGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR
Ga0207641_1169484123300026088Switchgrass RhizosphereTRLDGEKIITGGFTENKLKKLKGLRLTFPSLSTVLARQMGRGAIACCK
Ga0207648_1000082013300026089Miscanthus RhizosphereSLRDGEKITIGGWVENKLKKLKGLRFTCPFLSMVEAKQTGLGAITCCR
Ga0207648_1094897813300026089Miscanthus RhizosphereLREGEKTTIGGWVENKLKKLKGLRFTWPFLSIVEAKQIGLGAITCCR
Ga0207676_1167768223300026095Switchgrass RhizosphereEKITMGGLEENKLKKLNGLRFILPALSIVEAKQTGLGATTCCR
Ga0207698_1183465013300026142Corn RhizosphereEGEKTTIGGRVEKRLKKLKGLRFTFPSLSIVLAKQIGRGAMACCSQCWVSCTDI
Ga0209468_105677523300026306SoilSNVCLVVLSLILLAGEKMTIGGLDENKLKKLKGVRFTFPSLSIVDAKQIGRGAITCWR
Ga0209797_1000981113300027831Wetland SedimentENITMGGLVENKLKKLKGLRFTLPALSMVDAKQIGLGAITCCR
Ga0247749_104183623300027993SoilTIGGFEENILKKLNGLRLTFPSLSMVEAKQIGLGAMICWR
Ga0311371_1147956913300029951PalsaDGEKTQVGGLEPNKLKKLKGLRFTLPFLSTVEAKHIGRGAMAYCR
Ga0299906_1073152713300030606SoilVLFLTRRDGEKIITGGLEENKLKKLKGLRFTLPSLSIVLAKQIGLGAITCCR
Ga0074002_1002970023300031086SoilLLAGENIRIGGFEENKLKKLKGERFIFPSLSVVDAKQTGRGAMAC
Ga0302347_107598623300031372Leaf SurfaceGLVLNILKKLKGLKFIFPSASIVEAKQIGRGAMAYCR
Ga0307410_1195332013300031852RhizosphereVVLSRTLRDGEKITMGGFVENRLKKLKGLRLTVPCLSMVDAKQMGRGATRCCK
Ga0307409_10155027413300031995RhizosphereLVVLSLTRREGEKTQIGGQMLNKLKKLKGLKLTLPSLSIVEAKQIGRGAIAYCR
Ga0334944_058991_504_6623300034009Sub-Biocrust SoilVLSLTRLEGEKITMGGLEENILKKLKGLRFTFPSLSMVEAKQTGLGAMICCR
Ga0334998_0294598_820_9663300034019FreshwaterTLLAGEKTTIGGLDENKLKKLNGLRFICPSLSMVEAKHIGRGAMECCR
Ga0370510_0139737_30_1913300034160Untreated Peat SoilVVLSLTRLAGEKITTGGLEENKLKKLKGLRFTWPTLSIVDAKQIGLGAIACCR
Ga0334939_0111789_47_2053300034175BiocrustVLSLTRLEGEKTTIGGLEENILKKLKGLRFTFLSLSIVDAKQIGRGAITCCR
Ga0335013_0256014_1_1293300034284FreshwaterNLVGFEPKILKKLNGLKFGLPSLSIVLAKQMGLGAIAVNKVL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.