NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081690

Metagenome / Metatranscriptome Family F081690

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081690
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 43 residues
Representative Sequence MGLAHWDEVESHRRAKGEMDAVWQRLGDAAGTKGVGVNRVRVEP
Number of Associated Samples 98
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.72 %
% of genes near scaffold ends (potentially truncated) 98.25 %
% of genes from short scaffolds (< 2000 bps) 92.11 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.684 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(8.772 % of family members)
Environment Ontology (ENVO) Unclassified
(23.684 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.614 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.11%    β-sheet: 26.39%    Coil/Unstructured: 62.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00294PfkB 17.54
PF00484Pro_CA 8.77
PF03618Kinase-PPPase 7.02
PF00107ADH_zinc_N 3.51
PF07650KH_2 3.51
PF00353HemolysinCabind 1.75
PF11578DUF3237 1.75
PF00150Cellulase 1.75
PF08327AHSA1 0.88
PF05437AzlD 0.88
PF02272DHHA1 0.88
PF00455DeoRC 0.88
PF02896PEP-utilizers_C 0.88
PF03704BTAD 0.88
PF02230Abhydrolase_2 0.88
PF12840HTH_20 0.88
PF13417GST_N_3 0.88
PF07883Cupin_2 0.88
PF02913FAD-oxidase_C 0.88
PF13860FlgD_ig 0.88
PF01472PUA 0.88
PF01156IU_nuc_hydro 0.88
PF01326PPDK_N 0.88
PF00892EamA 0.88
PF08220HTH_DeoR 0.88
PF00583Acetyltransf_1 0.88
PF03449GreA_GreB_N 0.88
PF14016DUF4232 0.88
PF09992NAGPA 0.88
PF00072Response_reg 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 8.77
COG1806Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities)Signal transduction mechanisms [T] 7.02
COG1349DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR familyTranscription [K] 1.75
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 1.75
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 1.75
COG0120Ribose 5-phosphate isomeraseCarbohydrate transport and metabolism [G] 0.88
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.88
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.88
COG0782Transcription elongation factor, GreA/GreB familyTranscription [K] 0.88
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.88
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.88
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.68 %
UnclassifiedrootN/A26.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig63600All Organisms → cellular organisms → Bacteria777Open in IMG/M
2170459002|F0B48LX02GYH9YAll Organisms → cellular organisms → Bacteria500Open in IMG/M
3300000956|JGI10216J12902_126735998All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300001535|A3PFW1_10298480All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300002568|C688J35102_117860494All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300002568|C688J35102_120794917Not Available1601Open in IMG/M
3300004081|Ga0063454_100319939All Organisms → cellular organisms → Bacteria → Terrabacteria group984Open in IMG/M
3300004156|Ga0062589_102887647Not Available502Open in IMG/M
3300004479|Ga0062595_100352987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1025Open in IMG/M
3300004479|Ga0062595_102259991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300005331|Ga0070670_100166345All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300005332|Ga0066388_101510190All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005332|Ga0066388_101719286All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300005338|Ga0068868_101676390All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300005434|Ga0070709_10143682Not Available1642Open in IMG/M
3300005435|Ga0070714_100314632All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300005435|Ga0070714_102103821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300005436|Ga0070713_100696225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300005437|Ga0070710_10630721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300005439|Ga0070711_100655337All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300005454|Ga0066687_10570768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300005529|Ga0070741_11589806All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005541|Ga0070733_10316521Not Available1032Open in IMG/M
3300005544|Ga0070686_100764576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300005548|Ga0070665_100844071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium929Open in IMG/M
3300005549|Ga0070704_100667488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria919Open in IMG/M
3300005557|Ga0066704_10942135Not Available533Open in IMG/M
3300005575|Ga0066702_10273062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1031Open in IMG/M
3300005577|Ga0068857_102003623Not Available568Open in IMG/M
3300005578|Ga0068854_102270999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300005614|Ga0068856_101517699All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005764|Ga0066903_105858464All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300006028|Ga0070717_10035751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4025Open in IMG/M
3300006032|Ga0066696_10308438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M
3300006058|Ga0075432_10461693Not Available559Open in IMG/M
3300006173|Ga0070716_100283940Not Available1143Open in IMG/M
3300006173|Ga0070716_101658038Not Available526Open in IMG/M
3300006797|Ga0066659_11891917All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300006852|Ga0075433_11445360All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006852|Ga0075433_11531068All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300009093|Ga0105240_10075519All Organisms → cellular organisms → Bacteria4157Open in IMG/M
3300009156|Ga0111538_10993153Not Available1062Open in IMG/M
3300009156|Ga0111538_13129727All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300009789|Ga0126307_10059606All Organisms → cellular organisms → Bacteria2992Open in IMG/M
3300009840|Ga0126313_10283782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1291Open in IMG/M
3300009840|Ga0126313_11019208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300010040|Ga0126308_10761110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300010040|Ga0126308_11059854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300010042|Ga0126314_10912464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300010361|Ga0126378_12707299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300010375|Ga0105239_12208256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300010375|Ga0105239_12337744Not Available622Open in IMG/M
3300010376|Ga0126381_101291120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300010376|Ga0126381_103558542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria611Open in IMG/M
3300010399|Ga0134127_13418114All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300010403|Ga0134123_11014201Not Available847Open in IMG/M
3300011119|Ga0105246_11675528Not Available603Open in IMG/M
3300012045|Ga0136623_10058478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300012357|Ga0137384_11202201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300012527|Ga0136633_1256470Not Available640Open in IMG/M
3300012915|Ga0157302_10485977Not Available530Open in IMG/M
3300012922|Ga0137394_10599010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300012960|Ga0164301_10193462Not Available1290Open in IMG/M
3300012977|Ga0134087_10467933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300012977|Ga0134087_10475626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300012984|Ga0164309_10051930All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300012985|Ga0164308_11210968All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012989|Ga0164305_10140312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1624Open in IMG/M
3300013104|Ga0157370_10128768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2362Open in IMG/M
3300013104|Ga0157370_10345819Not Available1371Open in IMG/M
3300013105|Ga0157369_10989014All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300013294|Ga0120150_1093605Not Available569Open in IMG/M
3300013772|Ga0120158_10277626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300013772|Ga0120158_10285240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300014827|Ga0120171_1010307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4312Open in IMG/M
3300014968|Ga0157379_11955777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes579Open in IMG/M
3300015261|Ga0182006_1163049Not Available750Open in IMG/M
3300015265|Ga0182005_1132906All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300015357|Ga0134072_10492656All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300017789|Ga0136617_10465713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1010Open in IMG/M
3300017974|Ga0187777_10191199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1377Open in IMG/M
3300018482|Ga0066669_10757832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300020075|Ga0206349_1962161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300020076|Ga0206355_1050741All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300025929|Ga0207664_10419236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1192Open in IMG/M
3300025932|Ga0207690_10094805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2118Open in IMG/M
3300025949|Ga0207667_11652226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium608Open in IMG/M
3300025981|Ga0207640_11817210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300026075|Ga0207708_10292167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1323Open in IMG/M
3300026075|Ga0207708_11057225Not Available707Open in IMG/M
3300026078|Ga0207702_10523711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1157Open in IMG/M
3300026095|Ga0207676_11875062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300026116|Ga0207674_10652709All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300026528|Ga0209378_1218954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300027703|Ga0207862_1252991Not Available516Open in IMG/M
3300027869|Ga0209579_10588326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300028573|Ga0265334_10119288Not Available943Open in IMG/M
3300028666|Ga0265336_10116991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300028666|Ga0265336_10165648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300028872|Ga0307314_10062530All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300028881|Ga0307277_10027784All Organisms → cellular organisms → Bacteria2242Open in IMG/M
3300030513|Ga0268242_1138527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300031170|Ga0307498_10282974Not Available614Open in IMG/M
3300031341|Ga0307418_1082884Not Available842Open in IMG/M
3300031572|Ga0318515_10552133Not Available614Open in IMG/M
3300031640|Ga0318555_10474627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300031793|Ga0318548_10608129Not Available532Open in IMG/M
3300031821|Ga0318567_10206910Not Available1096Open in IMG/M
3300031939|Ga0308174_10476200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1018Open in IMG/M
3300032064|Ga0318510_10391808Not Available590Open in IMG/M
3300032074|Ga0308173_10631468Not Available973Open in IMG/M
3300032770|Ga0335085_10189153Not Available2533Open in IMG/M
3300033551|Ga0247830_10704258All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300033803|Ga0314862_0086369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.14%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.14%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.26%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.39%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.51%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.63%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.75%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.88%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.88%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.88%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012527Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06)EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020076Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030513Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031341Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0600.000042802166559005SimulatedMTVAHWDEVDWRHNAKGEMDATWQRLGDSAGARGVGVNRVRVEPGKLPTPPTR
E1_003961402170459002Grass SoilMTVAHWDEVDWRHNAKGEMDATWQRLGDSAGARGVGVNRVRVEPGKAADASHSHGASEDALLRPGGSGL
JGI10216J12902_12673599813300000956SoilVIAHWDEVEARRRAKGEMDAEWQRLGDAAGTVGVGV
A3PFW1_1029848013300001535PermafrostMGIAHWDDVERHHRAKGEMDATWQRLGHPAGTKGVGVNRVC
C688J35102_11786049423300002568SoilMTVAHWDDVPARRFAKGEMDASWQLLGDAAGTQGVGVNRVR
C688J35102_12079491713300002568SoilVVWQHGAMGVAHWDDVEWRRRAKGAMDASWQRLGDAAGARDVGINRVR
Ga0063454_10031993913300004081SoilMLAHWDDVDLRRREVGEMAASWQRLGDVAGTVRLGVNRVRVDP*
Ga0062589_10288764713300004156SoilMGVAHWDEVVWQRRAKGAMDASWQRLGDAAGTSAVGVNRV
Ga0062595_10035298743300004479SoilVAVSHWDEVESFRSAKGEMDATWQRLGDAAGTRVVGVNRVRVEPGKLPT
Ga0062595_10225999123300004479SoilVGLAHWDDVEGHHRAKGEMDATWQRLGREAGTKTVGLNRV
Ga0070670_10016634543300005331Switchgrass RhizosphereVPPVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNR
Ga0066388_10151019033300005332Tropical Forest SoilVTVAHWDEVEFHRSAKGEMDASWQVLGDAAGTRGVGVRRCRVEPG
Ga0066388_10171928633300005332Tropical Forest SoilVTVAHWDEVGSHRRAKGEMDATWQWLGNAAGTRSVGVNRVRVAPGKLPTPPHSHGAS
Ga0068868_10167639023300005338Miscanthus RhizosphereMTVAHWDEVDWRHNAKGEMDATWQGLGDAAGTRGVGVNRVRVEPGK
Ga0070709_1014368243300005434Corn, Switchgrass And Miscanthus RhizosphereMGVAHWDEVESHHRAKGEMGATWQAVGNAAGTVTVGVNRI
Ga0070714_10031463213300005435Agricultural SoilMGVAHWDEVEGQARAKGEMDATWQALGDAAGTRSVGVNLVRVAPGKLPTPPHSH
Ga0070714_10210382113300005435Agricultural SoilVTVAHWDEVESRHRAKGEMDGTWQALGDAAGTRGVGVNRVR
Ga0070713_10069622523300005436Corn, Switchgrass And Miscanthus RhizosphereVGVAHWDEIERQHRAKGEMDATWQRLGSPAGARTVGLNRVRVAAGKLPTPPHSH
Ga0070710_1063072113300005437Corn, Switchgrass And Miscanthus RhizosphereMGVAHWDEVESFRGAKGEMDATWQRLGAAAGAQGVGVNRVRVAP
Ga0070711_10065533713300005439Corn, Switchgrass And Miscanthus RhizosphereVPLVGIVHWDDIEQHRAAKGEMDATWQQLGKAAGAVGIGVN
Ga0066687_1057076813300005454SoilMGVAHWDEVGSHHAAKGEMDAEWQWLGHAAGTRGVGVNRVRVAPGRLP
Ga0070741_1158980613300005529Surface SoilMGVAHWDEVESFRNAKGEMDATWQRLGDAAGTKGVGVNRVRVAPG
Ga0070733_1031652113300005541Surface SoilVAHWDDVEGHRAAKGEMDAMWQRLGDAAGTRSVGVNRVRVE
Ga0070686_10076457613300005544Switchgrass RhizosphereMTVAHWDEVDWRHNAKGEMDATWQRLGDAAGARGVGVNRV
Ga0070665_10084407133300005548Switchgrass RhizosphereMTVAHWDEVDWRRNAKGEMDATWQRLGDAAGARGVGVNRVRI
Ga0070704_10066748833300005549Corn, Switchgrass And Miscanthus RhizosphereMTVAHWDEVDWRHNAKGEMDATWQRLGDAAGARGVGVNRVRVEPGKL
Ga0066704_1094213523300005557SoilMGVAHWDEVGSHHAAKGEMDAEWQWLGHAAGTRGVGVNRVRV
Ga0066702_1027306233300005575SoilVEGLAHWDDVEWHHRAKGEMDATWQFLGRAAGVVGV
Ga0068857_10200362313300005577Corn RhizosphereMGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRL
Ga0068854_10227099913300005578Corn RhizosphereVGLAHWDDVAAHRAAKGEMDAEWQRLGDAAGSVTVGLS
Ga0068856_10151769933300005614Corn RhizosphereMGVAHWDEVEFHRRSKGEMDASWQWLGHASGTRGVGVNRVRVEP
Ga0066903_10585846423300005764Tropical Forest SoilMGLAHWDDVEFHRSAKGEMDASWQRLGNAAGTRKVGVSR
Ga0070717_1003575153300006028Corn, Switchgrass And Miscanthus RhizosphereVGLAHWDEIERQHRAKGEMDATWQRLGSPAGARTVGLNRVRVAAGKLPTPPHS
Ga0066696_1030843833300006032SoilVTVAHWDEVETFRSAKGEMDATWQRLGAAAGTRAVGVNRVR
Ga0075432_1046169323300006058Populus RhizosphereVLAHWDEIEANRREKGEMAASWQRLGSAAGTRAVGVNRVRID
Ga0070716_10028394013300006173Corn, Switchgrass And Miscanthus RhizosphereMTVAHWDEVDWRHNAKGEMDATWQRLGDAAGARGVG
Ga0070716_10165803813300006173Corn, Switchgrass And Miscanthus RhizosphereVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRM
Ga0066659_1189191713300006797SoilMGIVHWDDVERQRRAKGEMDAEWQILGDAAGTTGVGV
Ga0075433_1144536023300006852Populus RhizosphereMTVAHWDEVEARRNAKGEMDATWQALGKAAGTRGVGVNRVRV
Ga0075433_1153106813300006852Populus RhizosphereVLAHWDEIEADRREKGEMAASWQRLGSAAGTRAVGVNRVRIDPGRLS
Ga0105240_1007551953300009093Corn RhizosphereVGIAHWDEVEGHRNAKGEMDATWQFLGRASGSQGVGVN
Ga0111538_1099315333300009156Populus RhizosphereVTVAHWDDVETHHRAKGEMDATWQRLGDAAGTRGV
Ga0111538_1312972713300009156Populus RhizosphereVTLAHWDEVEERRRAKGEMDATWQRLGDAAGTKGVGVSRVRVAPGKLPT
Ga0126307_1005960613300009789Serpentine SoilVSVAHWDDVESRHRAKGEMDAVWQRVGDAAGTRGVGVSRVRV
Ga0126313_1028378213300009840Serpentine SoilMTVSHWDEVESYRRAKGEMNGTWQRLGDAAGTRGVGVNRVRLEPGA
Ga0126313_1101920823300009840Serpentine SoilVGHIRNDPAVSVAHWDEVQSQHRAKGEMDAVWQRLGDAAGTRGVGV
Ga0126308_1076111033300010040Serpentine SoilVSVAHWDEVQSQHRAKGEMDAVWQRLGDAAGTRGVGVNRV
Ga0126308_1105985413300010040Serpentine SoilVGHIRNDPAVSVAHWDEVQSQHRAKGEMDAVWQRLGDAAGTRGVGVNRV
Ga0126314_1091246413300010042Serpentine SoilVIAHWDEVGWHRREKGEMGGDWQRLGDAAGTDGVGVNRVRID
Ga0126378_1270729913300010361Tropical Forest SoilMTVAHWDEVDSRHAAKGEMDATWQRLGNAAGTRGVGVARVQVAPGKLPTP
Ga0105239_1220825613300010375Corn RhizosphereMGLAHWDEVEGHRAAKGEMDAEWQMLGRAAGTAGVGVN
Ga0105239_1233774423300010375Corn RhizosphereVGLAHWDDVEGRRAAKGEMDAEWQMLGRAAGTAGVG
Ga0126381_10129112043300010376Tropical Forest SoilMTVANWDEVEEIVRAKGEMDGIWQAVGAAAGTRGVGVNRVRVAPGKLPTPPH
Ga0126381_10355854223300010376Tropical Forest SoilMGVAHWDEVEFFRSAKGEMDASWQRLGDEAGTREVGVRR
Ga0134127_1341811423300010399Terrestrial SoilMGLAHWDDVEPRHRAKGEMDATWKRLGEAAGTKGV
Ga0134123_1101420113300010403Terrestrial SoilVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIG
Ga0105246_1167552823300011119Miscanthus RhizosphereVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVN
Ga0136623_1005847843300012045Polar Desert SandMGIAHWDDVEHTRRAKGEMDATWQRLGQAAGTKGVGLN
Ga0137384_1120220113300012357Vadose Zone SoilVTVAHWDEVETFRSAKGEMDATWQRLGAAAGTRAVGMNRVRV
Ga0136633_125647013300012527Polar Desert SandMGLAHWDDVEQHRRAKGEMDATWQRLGDATGTKGV
Ga0157302_1048597723300012915SoilMGVAHWDEVDFRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRV
Ga0137394_1059901023300012922Vadose Zone SoilVGIAHWDDVDAHHRSNGELDAMWQLLGRAAGTQEVGVNRVRVAPGRLP
Ga0164301_1019346233300012960SoilVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNR
Ga0134087_1046793323300012977Grasslands SoilVNRTGVVHWDDVERRHRALGELDATWRILGEAAGTVT
Ga0134087_1047562613300012977Grasslands SoilVGVAHWEDVEWHRLAKGEMDAELQRLGRAAGAVGVGVNRVRVAPGRLPTPPHSHGAA*
Ga0164309_1005193043300012984SoilVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRMRVAPG
Ga0164308_1121096833300012985SoilLAAVTVAHWDEVEFHRSAKGQMDAEWQWLGRAAGTKRVGVNRVRVAPGKL
Ga0164305_1014031233300012989SoilVGTAHWDEVEQHRRAKGEMDATWQFLGRAAGAQGVGLN
Ga0157370_1012876853300013104Corn RhizosphereVGVAHWDEVEGHHRAKGEMDATWHFLGRAAGTKTVGVNRVHVAPG
Ga0157370_1034581933300013104Corn RhizosphereVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRMRVAPGRLPTPPHS
Ga0157369_1098901413300013105Corn RhizosphereMGVAHWDEVDSNHRAKGEMDATWQSLGNAAGTRGVGVNRV
Ga0120150_109360513300013294PermafrostVSPIVHWDDVEQRRNAKGEMDATWQRLGRTAGAVGVGVN
Ga0120158_1027762613300013772PermafrostMGLAHWDDVERMHRAKGEMDAEWQRLGDAARVGGGGLH
Ga0120158_1028524023300013772PermafrostVGLAHWDDIEGHHRAKGEMDATWQRLGAPAGAKTVGLNRVN
Ga0120171_101030753300014827PermafrostVGIAHWDDVEPERRAKGEMDATWQRLGAPARTKGVGLNRGG
Ga0157379_1195577713300014968Switchgrass RhizosphereVGLAHWDDVATYRGAKGEMDAEWQRLGDAAGSVGVGLSRVRV
Ga0182006_116304923300015261RhizosphereVGLAHWDEVDEHRSAKGEMDAVWQMLGRAAGTTGVGVNRVRVAPGK
Ga0182005_113290633300015265RhizosphereMGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRLPTPPHSHSASEE
Ga0134072_1049265613300015357Grasslands SoilMGVAHWDEVEFHRSAKGEMDAEWQWLGHAAGTCGVGVNRVRVAPGR
Ga0136617_1046571323300017789Polar Desert SandMGIVHWDEVERHRRAKGEMDATWQRLGQAAGTKGVGVN
Ga0187777_1019119913300017974Tropical PeatlandMGLAHWDDVLEHRSAKGELDAVWQRLGDAAGTVGVGVNRVRVAP
Ga0066669_1075783213300018482Grasslands SoilVTVAHWDEVETFRSAKGEMDATWQRLGAAAGTRAVGVNRVRV
Ga0206349_196216113300020075Corn, Switchgrass And Miscanthus RhizosphereVTVAHWDEVETFRSAKGEMDATWQRLGAAAGARAVG
Ga0206355_105074133300020076Corn, Switchgrass And Miscanthus RhizosphereMGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRLPTPPHSHSASE
Ga0207664_1041923613300025929Agricultural SoilMGVAHWDEVEPHTRAKGEMDASWQWLGNAAGTRGV
Ga0207690_1009480533300025932Corn RhizosphereVGLAHWDDVDERRAAKGEMDAVWQMLGRAAGTAGVGLNRIR
Ga0207667_1165222613300025949Corn RhizosphereMGIAHRDEVEEHRAAKGEMDAVWKRIGAAAGAKTVGVNLVTVA
Ga0207640_1181721013300025981Corn RhizosphereVGLAHWDDVAAHRAAKGEMDAEWQRLGDAAGSVTVGLSRVRVA
Ga0207708_1029216713300026075Corn, Switchgrass And Miscanthus RhizosphereMGLAHWDDVEGFRRAKGEMDATWQRLGDAAGTKDVGLN
Ga0207708_1105722513300026075Corn, Switchgrass And Miscanthus RhizosphereVGIVHWDDIERHRAAKGEMDATWQQLGKAAGAVGIGVNRMRVAPGRLPTPP
Ga0207702_1052371133300026078Corn RhizosphereMGVAHWDEVDSNHRAKGEMDATWQSLGNAAGTRGVGVNRVRVEPGRLPTPPHSHGA
Ga0207676_1187506213300026095Switchgrass RhizosphereMGLAHWDDVEGFRRAKGEMDATWQRLGDAAGTKDVGLNRVRVAP
Ga0207674_1065270933300026116Corn RhizosphereMGVAHWDEVDSRRSAKGEMDAEWQWLGRAAGTRGVGVNRVRVAPGRLPT
Ga0209378_121895413300026528SoilMTVAHWDEVESRRNAKGEMDATWQRLGDAAGTSGVGVNRVRIERG
Ga0207862_125299123300027703Tropical Forest SoilVGLAHWDDVPEHHAAKGEMDAVWQRLGAAAGTAGVGV
Ga0209579_1058832613300027869Surface SoilMSVVHWDEVDFHRSAKGEMDASSQFLGDAAGTRGVGVNRVRVEPGKLPT
Ga0265334_1011928823300028573RhizosphereMGVAHWDEVEGHRPAKGEMDATWQRLGDAAVTKSVGV
Ga0265336_1011699113300028666RhizosphereVGVAHWDDVESFHRAKGEMDATWQALGRAAGTRGV
Ga0265336_1016564813300028666RhizosphereMGVAHWDEVAEFRAAKGEMDAVWQRLGDAAGTQGVGVNRVRVEPGKL
Ga0307314_1006253033300028872SoilMSVAHWDDVEWHRRAKGAMDASWQRLGGAAGASGVGVNRVRVA
Ga0307277_1002778453300028881SoilVGIAHWDEVEAHRRAKGEMDAEWQLLGNAAGTVGVGVNRVRI
Ga0268242_113852723300030513SoilMGIAHWDEVEWRRNAKGEMALSVQRLGRAAGTKGVGVNRVRV
Ga0307498_1028297413300031170SoilVGIVHWDDIERHRAAKGEMDATWQQLAKPAGAVGIGVNRMRVAPGKLPTPPHSHGA
Ga0307418_108288423300031341Salt MarshVTVAHWDEVEGSRRSRGEMDATWQRLGDAAGTRGVGVNRVRVEPGRL
Ga0318515_1055213323300031572SoilVTVAHWDEVEERVRAKGEMDGIWQAVGEAAGTRGVGVNRVRVPPGK
Ga0318555_1047462723300031640SoilMGVAHWDEVETHRAAKGEMDAVWQRLGSHAGTVGVGVS
Ga0318548_1060812923300031793SoilMNPPKGVVHWDEVEGHHAERGEMAATWRRLGHAAGTKTVGV
Ga0318567_1020691013300031821SoilMNPPKGVVHWDEVEGHHAERGEMAATWRRLGHAAGTKTVG
Ga0308174_1047620023300031939SoilVGLAHWDDVEPRCTAKGEMDAEWQRLGDAAGTVGVG
Ga0318510_1039180823300032064SoilMNPPKGVVHWDEVEGHHAERGEMAATWRRLGHAAGTKTVGVS
Ga0308173_1063146833300032074SoilMAVAHWDDVEWHRRAKGAMDASWQRLGDAAGTSGVGVNRV
Ga0335085_1018915333300032770SoilMGIAHWDEVEFHRAANGEIDASWQRLGATAGAVGVGVNRVRVAPGM
Ga0247830_1070425823300033551SoilMGLAHWDEVESHRRAKGEMDAVWQRLGDAAGTKGVGVNRVRVEP
Ga0314862_0086369_576_7133300033803PeatlandMGVAHWDNVESHRLSKGEMDATWQALGNAAGTVTVGVNRVRVEPGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.