NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F081555

Metagenome / Metatranscriptome Family F081555

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081555
Family Type Metagenome / Metatranscriptome
Number of Sequences 114
Average Sequence Length 44 residues
Representative Sequence RIYGSANTKGFGRGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY
Number of Associated Samples 105
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.37 %
% of genes from short scaffolds (< 2000 bps) 87.72 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.088 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(12.281 % of family members)
Environment Ontology (ENVO) Unclassified
(43.860 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.491 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 23.29%    Coil/Unstructured: 76.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF00698Acyl_transf_1 26.32
PF02504FA_synthesis 7.89
PF04255DUF433 6.14
PF02620YceD 3.51
PF12146Hydrolase_4 1.75
PF05015HigB-like_toxin 0.88
PF12850Metallophos_2 0.88
PF13565HTH_32 0.88
PF13701DDE_Tnp_1_4 0.88
PF01960ArgJ 0.88
PF00132Hexapep 0.88
PF06230LpxI_C 0.88
PF12760Zn_Tnp_IS1595 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG0416Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis)Lipid transport and metabolism [I] 7.89
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 6.14
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 3.51
COG1364Glutamate N-acetyltransferase (ornithine transacetylase)Amino acid transport and metabolism [E] 0.88
COG3494Uncharacterized conserved protein, DUF1009 familyFunction unknown [S] 0.88
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.09 %
UnclassifiedrootN/A14.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10250566All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300004152|Ga0062386_100155260All Organisms → cellular organisms → Bacteria1787Open in IMG/M
3300005538|Ga0070731_10901452All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005921|Ga0070766_10163880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1370Open in IMG/M
3300005993|Ga0080027_10058312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans → Syntrophobacter fumaroxidans MPOB1405Open in IMG/M
3300006162|Ga0075030_101111364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300006176|Ga0070765_102041810Not Available536Open in IMG/M
3300006796|Ga0066665_10027261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui3692Open in IMG/M
3300009029|Ga0066793_10691222Not Available580Open in IMG/M
3300009523|Ga0116221_1094552Not Available1326Open in IMG/M
3300009624|Ga0116105_1250140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300009635|Ga0116117_1082152All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300009645|Ga0116106_1045258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1479Open in IMG/M
3300009646|Ga0116132_1160189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300009683|Ga0116224_10011753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui4389Open in IMG/M
3300009700|Ga0116217_10842060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300009700|Ga0116217_11030973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300009764|Ga0116134_1222587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300010341|Ga0074045_10082040All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.2255Open in IMG/M
3300010379|Ga0136449_100816347All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300010379|Ga0136449_102186517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300010379|Ga0136449_102382919All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300011271|Ga0137393_10770077All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300012206|Ga0137380_11484515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300012356|Ga0137371_10875242All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012362|Ga0137361_11327312All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018643Open in IMG/M
3300012917|Ga0137395_10450067All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300012923|Ga0137359_11369965Not Available595Open in IMG/M
3300012925|Ga0137419_10111471All Organisms → cellular organisms → Bacteria → Acidobacteria1914Open in IMG/M
3300014169|Ga0181531_10369370Not Available881Open in IMG/M
3300014491|Ga0182014_10127861All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300014499|Ga0182012_10186796All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300014502|Ga0182021_10280991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1956Open in IMG/M
3300014502|Ga0182021_10398421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1633Open in IMG/M
3300014838|Ga0182030_11005241All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300015242|Ga0137412_11089691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300016357|Ga0182032_10327861All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300017929|Ga0187849_1190959All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300017933|Ga0187801_10212854All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300017935|Ga0187848_10471943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300017940|Ga0187853_10033372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2734Open in IMG/M
3300017940|Ga0187853_10364456All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300017946|Ga0187879_10025003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3656Open in IMG/M
3300017966|Ga0187776_10091247All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1800Open in IMG/M
3300017972|Ga0187781_10020495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4612Open in IMG/M
3300017975|Ga0187782_10403408All Organisms → cellular organisms → Bacteria → Acidobacteria1039Open in IMG/M
3300017988|Ga0181520_10398504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae999Open in IMG/M
3300017998|Ga0187870_1282148All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300018020|Ga0187861_10105588All Organisms → cellular organisms → Bacteria → Acidobacteria1351Open in IMG/M
3300018021|Ga0187882_1380599All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300018033|Ga0187867_10409259All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300018034|Ga0187863_10055435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2258Open in IMG/M
3300018038|Ga0187855_10145950Not Available1413Open in IMG/M
3300018038|Ga0187855_10180592All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300018043|Ga0187887_10259862Not Available1027Open in IMG/M
3300018057|Ga0187858_10696117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300018062|Ga0187784_10111164All Organisms → cellular organisms → Bacteria2233Open in IMG/M
3300018085|Ga0187772_11054168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300018088|Ga0187771_11283479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300019787|Ga0182031_1451334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71486Open in IMG/M
3300021170|Ga0210400_11304266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300021181|Ga0210388_11414538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300021474|Ga0210390_11334143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300021861|Ga0213853_10705863All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300023255|Ga0224547_1006801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1426Open in IMG/M
3300025454|Ga0208039_1054887All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300025527|Ga0208714_1020499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1617Open in IMG/M
3300026318|Ga0209471_1189484All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300026557|Ga0179587_10241617Not Available1154Open in IMG/M
3300026557|Ga0179587_10424798All Organisms → cellular organisms → Bacteria → Acidobacteria868Open in IMG/M
3300027334|Ga0209529_1021317Not Available1099Open in IMG/M
3300027605|Ga0209329_1093930All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300027634|Ga0209905_1006116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1448Open in IMG/M
3300027729|Ga0209248_10138105All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027829|Ga0209773_10237760All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300027862|Ga0209701_10028303All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3648Open in IMG/M
3300027862|Ga0209701_10545977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300027869|Ga0209579_10543479All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300027911|Ga0209698_11107269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300028268|Ga0255348_1015342All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300028562|Ga0302151_10294107Not Available539Open in IMG/M
3300028731|Ga0302301_1093475All Organisms → cellular organisms → Bacteria → Acidobacteria776Open in IMG/M
3300028745|Ga0302267_10007116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11109Open in IMG/M
3300028748|Ga0302156_10436213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300028806|Ga0302221_10381021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300029883|Ga0311327_10032836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4260Open in IMG/M
3300029943|Ga0311340_11140453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300029957|Ga0265324_10074778Not Available1153Open in IMG/M
3300030041|Ga0302274_10111550All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300030044|Ga0302281_10049725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2138Open in IMG/M
3300030054|Ga0302182_10330745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300030399|Ga0311353_10652853Not Available913Open in IMG/M
3300030507|Ga0302192_10173319Not Available946Open in IMG/M
3300030688|Ga0311345_10094948All Organisms → cellular organisms → Bacteria3431Open in IMG/M
3300030707|Ga0310038_10305046All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300031128|Ga0170823_11124299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300031231|Ga0170824_123854203All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300031242|Ga0265329_10123869All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300031249|Ga0265339_10134920Not Available1259Open in IMG/M
3300031259|Ga0302187_10120904All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300031521|Ga0311364_10410464Not Available1373Open in IMG/M
3300031708|Ga0310686_115044678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300031712|Ga0265342_10622453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300031910|Ga0306923_12001695All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300032205|Ga0307472_102326608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300033433|Ga0326726_10635009Not Available1028Open in IMG/M
3300033433|Ga0326726_11554474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis644Open in IMG/M
3300033755|Ga0371489_0037898All Organisms → cellular organisms → Bacteria3420Open in IMG/M
3300033820|Ga0334817_043323Not Available892Open in IMG/M
3300033829|Ga0334854_171441All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300033983|Ga0371488_0323937All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300034091|Ga0326724_0521929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300034125|Ga0370484_0143004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis640Open in IMG/M
3300034163|Ga0370515_0297912All Organisms → cellular organisms → Bacteria682Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.53%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.89%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog7.02%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.26%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.26%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.39%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.39%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.51%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.51%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.75%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.75%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.75%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.75%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.88%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.88%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.88%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027634Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1MEnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033820Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-DEnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1025056613300001356Peatlands SoilGSANTKQLGGGGVVVEVIVNERAEHARMFAQKSDKTLTVYPY*
Ga0062386_10015526013300004152Bog Forest SoilVKSHRIYGSANTKGPFSGGVVVEVIVNERTEHARMFVQKSDKTITVYPY*
Ga0070731_1090145223300005538Surface SoilFGGGGVIVEVVVNERAEHARMFVQKSDKTITVYPY*
Ga0070766_1016388013300005921SoilGEWGLVKSHKIYGAANTKGFGGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPF*
Ga0080027_1005831243300005993Prmafrost SoilIYGSANTKGFGGGGVVVEVILNERAEHARMFVQKPDKTLTVYPY*
Ga0075030_10111136423300006162WatershedsSGTFGNAGGTVVEVIVNNRAEHARMFVQKSDNTLTVYPY*
Ga0070765_10204181013300006176SoilYGSANTKGFGGGGAVVEVIVNDRAEHARMFVQKSDKTLTVYPY*
Ga0066665_1002726163300006796SoilEWGLIKSYKIYGSATPKGGGSGVVVEVVVNNRAEHARVWVQKSDKTLSFSPF*
Ga0066793_1069122213300009029Prmafrost SoilLGRGGVVVEVVVNERSEHARMFVQKSDKTLTVYPF*
Ga0116221_109455213300009523Peatlands SoilRIYGSANTKGFGRGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY*
Ga0116105_125014013300009624PeatlandSANTRNFGGGGVVVEVIVNERSEHARMFVEKSDKTLTVYPY*
Ga0116117_108215213300009635PeatlandKKFGGGGVVVEVVINERSEHARMFVQKSDKTITVYPF*
Ga0116106_104525813300009645PeatlandKGFGSGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY*
Ga0116132_116018923300009646PeatlandANTKGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY*
Ga0116224_1001175363300009683Peatlands SoilLGSGGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY*
Ga0116217_1084206023300009700Peatlands SoilIKSHRIYGSANTKGFGGGGVVVEVIVNDRAEHARMFVQKSDKTLTVYPY*
Ga0116217_1103097323300009700Peatlands SoilGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY*
Ga0116134_122258713300009764PeatlandNTKGLAGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY*
Ga0074045_1008204033300010341Bog Forest SoilSHKIYGSANTKGFGGGGVVVEVIVNDRAEHARMFVQKSDKTLTVYPY*
Ga0136449_10081634713300010379Peatlands SoilKSHRIYGSANTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY*
Ga0136449_10218651713300010379Peatlands SoilGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY*
Ga0136449_10238291923300010379Peatlands SoilFGGGVIVEVVVNERAEHARMFVLRSDKTITVYPY*
Ga0137393_1077007713300011271Vadose Zone SoilLIKSHRIYGSANTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY*
Ga0137380_1148451523300012206Vadose Zone SoilIYGSASTKGGVVVEVIVNERADRARMFLEKSDKTLTVYPY*
Ga0137371_1087524223300012356Vadose Zone SoilYGSASTKGGVVVEVIVNERADRARMFLEKSDKTLTVYPY*
Ga0137361_1132731213300012362Vadose Zone SoilKSHRIYGSANTKGFGSGGVVVEVVVNDRAEHARMFVQKPDKTLTVYPY*
Ga0137395_1045006713300012917Vadose Zone SoilGEWGLVKSHRIYGSANTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY*
Ga0137359_1136996523300012923Vadose Zone SoilSANTKGFGSGGVVVEVVVNDRAEHARMFVQKSDKTLTVYPY*
Ga0137419_1011147133300012925Vadose Zone SoilEWGLIKTHRIYGSANTKGLGSGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY*
Ga0181531_1036937023300014169BogEWGLIKSHRVYGSANTKNFGGGGVVVEIIVNERSEHARMFVQRSDKTLTVYPY*
Ga0182014_1012786143300014491BogANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY*
Ga0182012_1018679643300014499BogTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY*
Ga0182021_1028099113300014502FenGGEWGLIKSHRIYGSANTKGFTSGGVVVEVIVNERTEHARMFVQRSDKTLTVYPY*
Ga0182021_1039842113300014502FenHRVYGSANTKGFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY*
Ga0182030_1100524123300014838BogADTKKFGGGGVIVEVIVNERSEHARMFVQKSDKTITVYPF*
Ga0137412_1108969113300015242Vadose Zone SoilLVKSHRIYGSASTPRGVVVEVVVNDRADRARMFVEKPDKTLTVYPY*
Ga0182032_1032786113300016357SoilHRIYGAAGTKGFGSGGGTVVEVIVNERAEHARMFVQKSDKTLTVYPF
Ga0187849_119095913300017929PeatlandGEWGLVKSHRIYGSANTKGFGGGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY
Ga0187801_1021285423300017933Freshwater SedimentSFGSGGVIVEVIVNERAEHARMFVQKSDKTITVYPY
Ga0187848_1047194313300017935PeatlandLIKSHRIYGSANTKGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY
Ga0187853_1003337213300017940PeatlandANTKGFGSGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY
Ga0187853_1036445623300017940PeatlandWGLVKSHRIYGSANTKGFGGGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY
Ga0187879_1002500353300017946PeatlandIYGSANTKGLAGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY
Ga0187776_1009124713300017966Tropical PeatlandRVSGSASIQGGVVVEVVVNDRADRARMFVLKSDKTLTVYPY
Ga0187781_1002049583300017972Tropical PeatlandANTKGFGGGGVIVEVIVNERAEHARMFVQRSDKTITVYPY
Ga0187782_1040340823300017975Tropical PeatlandADTKAFSGGGVIVEVVVNERSEHARMFVERSDKTVTVYPY
Ga0181520_1039850413300017988BogEWGLIKSHRIYGSANTKGFGGGGVIVEVVVNERTEHARMFVQKSDKTITVYPY
Ga0187870_128214813300017998PeatlandGSANTKGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY
Ga0187861_1010558813300018020PeatlandTKGFGSGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY
Ga0187882_138059913300018021PeatlandNTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY
Ga0187867_1040925913300018033PeatlandKGLAGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY
Ga0187863_1005543513300018034PeatlandWGLIKSHRIYGSANTKGFGGGGVIVEVVVNERTEHARMFVQKSDKTITVYPY
Ga0187855_1014595023300018038PeatlandANTKGFGGGGVVVEVIVNQRAEHARMFVQKSDKTLTVYPY
Ga0187855_1018059213300018038PeatlandIYGSANTKGFGGGGAVVEVIVNERAEHARMFVQKSDKTLTVYPY
Ga0187887_1025986213300018043PeatlandKSHRIYGSANTKGFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY
Ga0187858_1069611723300018057PeatlandGFGSGGVVVEVVVNERTEHARMFVQRSDKTLTVYPY
Ga0187784_1011116433300018062Tropical PeatlandLIKSFRIYGSADTKAFSGGGVIVEVVVNERSEHARMFVERSDKTVTVYPY
Ga0187772_1105416813300018085Tropical PeatlandKSHRIYGSADTQGFGCGGVIVEVIVNERAEHARMFVQRSDKTITVYPY
Ga0187771_1128347923300018088Tropical PeatlandGGEWGLIKSHRIYGSANTQGLTSGGVIVEVIVNERAEHARMFVQRSDKTITVYPY
Ga0182031_145133443300019787BogLGAGGEWGLIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0210400_1130426613300021170SoilNTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY
Ga0210388_1141453813300021181SoilHRIYGTANTKNFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY
Ga0210390_1133414313300021474SoilANTKNFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY
Ga0213853_1070586313300021861WatershedsIGNAGGTVVEVIVNERAEHARMFVQKSDKTLTVYPF
Ga0224547_100680133300023255SoilKSFGGGGVVVEVIVNERTEHARMFVQRSDKTLTVYPY
Ga0208039_105488713300025454PeatlandANTKGFGGGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY
Ga0208714_102049913300025527Arctic Peat SoilANTKSFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY
Ga0209471_118948423300026318SoilGLIKSHRIYGSANTKGFGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY
Ga0179587_1024161713300026557Vadose Zone SoilNTKGFGGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY
Ga0179587_1042479823300026557Vadose Zone SoilKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY
Ga0209529_102131723300027334Forest SoilSFGGGGAVVEVIVNERTEHARMFVQKSDKTLTVYPY
Ga0209329_109393013300027605Forest SoilGGEWGLVKSHRIYGAANTKGFGGGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY
Ga0209905_100611633300027634Thawing PermafrostGGEWGLIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0209248_1013810513300027729Bog Forest SoilTKQLGGGGVIVEVVVNERSEHARMFVQKSDKTLTVYPF
Ga0209773_1023776013300027829Bog Forest SoilKAFGGGGLVVEVIINERSEHARMFVQKSDKTLTVYPF
Ga0209701_1002830363300027862Vadose Zone SoilSHRIYGSANTIGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY
Ga0209701_1054597723300027862Vadose Zone SoilGEWGLIKSHRIYGSANTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY
Ga0209579_1054347913300027869Surface SoilKGFGGGGVIVEVVVNERAEHARMFVQKSDKTITVYPY
Ga0209698_1110726913300027911WatershedsIYGSANTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY
Ga0255348_101534213300028268SoilGLIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0302151_1029410713300028562BogIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0302301_109347523300028731PalsaANTKGFGAGGVLVEVIVNERSEHARMFVQRSDKTMTVYPF
Ga0302267_1000711613300028745BogSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0302156_1043621313300028748BogNTKGFAGGGVVVEVIVNDRSEHARMFVQKSDKTLTVYPY
Ga0302221_1038102123300028806PalsaHKIYGSANTKGFGAGGAVVEVIVNDRTEHARMFVQKSDKTLTVFPY
Ga0311327_1003283683300029883BogSHRIYGTADTKKFGGGGVIVEVIVNERSEHARMFVQKSDKTITVYPF
Ga0311340_1114045323300029943PalsaGGEWGLIKSHKIYGSANTKGFGAGGAVVEVIVNDRTEHARMFVQKSDKTLTVFPY
Ga0265324_1007477813300029957RhizosphereKSYRVYGSANTKGLGGGGVIVEVVVNERAEHARMFVQKTDRTITVYPY
Ga0302274_1011155013300030041BogNTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0302281_1004972513300030044FenGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0302182_1033074513300030054PalsaGGEWGLVKSHRIYGSANTKGFGAGGVLVEVIVNERSEHARMFVQRSDKTMTVYPF
Ga0311353_1065285323300030399PalsaGVIKSHKIYGSANTKGFGAGGAVVEVIVNDRTEHARMFVQKSDKTLTVFPY
Ga0302192_1017331923300030507BogGTADTKKFGGGGVVVEVVINERSEHARMFVQKSDKTITVYPF
Ga0311345_1009494853300030688BogGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0310038_1030504623300030707Peatlands SoilGGEWGLIKSHRIYGSANTKQLGGGGVVVEVIVNERAEHARMFAQKSDKTLTVYPY
Ga0170823_1112429923300031128Forest SoilLVKSHRIYGAANTKGFGGGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY
Ga0170824_12385420313300031231Forest SoilLIASTARPTRSFGGGGVVVEVIVNERSEHARMFVQKPDKTLTVYPY
Ga0265329_1012386923300031242RhizosphereVNTKGFGGGGVVVEIIVNERAEHARMFVQKSDKTLTVYPY
Ga0265339_1013492023300031249RhizosphereGGEWGLIKSFHIYGSAATKGLGGGVIVEVVVNERAERARMFVLRSDKTITVYPY
Ga0302187_1012090443300031259BogLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY
Ga0311364_1041046433300031521FenHRIYGSANTKGLMSGGVIVEVIVNERAEHARMFVQKSDKTITVYPY
Ga0310686_11504467813300031708SoilGSANTKNFGGGGVVVEVIVNERAEHARMFVDKSNKTLTVYPY
Ga0265342_1062245323300031712RhizosphereGLGGGGVIVEVVVNERAEHARMFVQKTDRTITVYPY
Ga0306923_1200169523300031910SoilGGGSGVVVEVEVNQRAEHARVWVQKSDKTMTFSPY
Ga0307472_10232660813300032205Hardwood Forest SoilWGLIKSYRIYGSANTKGFGRGGVIVEVIVNERSEHARMFVQKPDKTLTVYPF
Ga0326726_1063500913300033433Peat SoilHRIYGSAGTKSFGSGTIGNAGGTVVEVIVNNRAEHARMFVQKTDKTLTVYPF
Ga0326726_1155447413300033433Peat SoilGEWGLIKQHRIYGSVATKGGVVVEVIVNDRADRARMFVQKADKTLTVYPY
Ga0371489_0037898_1_1623300033755Peat SoilEWGLIKSHRIYGSANTKGFTGGGVVVEVIVNERTEHARMFVQKSDKTLTVYPY
Ga0334817_043323_761_8923300033820SoilYGSANTKSFGGGGVVVEVVVNERSEHERMFLQRSDKTLTVWPY
Ga0334854_171441_11_1633300033829SoilLIKSHKIYGSANTKNFGGGGVVVEVIINERSEHARMFVEKSDKTLTVYPY
Ga0371488_0323937_589_7293300033983Peat SoilSFRIYGSANTKGFGGGVIVEVVVNNRAEHARMFVTRSDKTVTVYPY
Ga0326724_0521929_437_6043300034091Peat SoilGGEWGLIKSHRIYGSANTKGFTGGGVVVEVIVNERTEHARMFVQKSDKTLTVYPY
Ga0370484_0143004_452_6403300034125Untreated Peat SoilFYRDWGPGSEWGLIKSHRIYGSANTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTLYPY
Ga0370515_0297912_569_6823300034163Untreated Peat SoilKNFGGGGVVVEIIVNERSEHARMFVQRSDKTLTVYPY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.