Basic Information | |
---|---|
Family ID | F081555 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 114 |
Average Sequence Length | 44 residues |
Representative Sequence | RIYGSANTKGFGRGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 114 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.37 % |
% of genes from short scaffolds (< 2000 bps) | 87.72 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.088 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (12.281 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.860 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.491 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.29% Coil/Unstructured: 76.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 114 Family Scaffolds |
---|---|---|
PF00698 | Acyl_transf_1 | 26.32 |
PF02504 | FA_synthesis | 7.89 |
PF04255 | DUF433 | 6.14 |
PF02620 | YceD | 3.51 |
PF12146 | Hydrolase_4 | 1.75 |
PF05015 | HigB-like_toxin | 0.88 |
PF12850 | Metallophos_2 | 0.88 |
PF13565 | HTH_32 | 0.88 |
PF13701 | DDE_Tnp_1_4 | 0.88 |
PF01960 | ArgJ | 0.88 |
PF00132 | Hexapep | 0.88 |
PF06230 | LpxI_C | 0.88 |
PF12760 | Zn_Tnp_IS1595 | 0.88 |
COG ID | Name | Functional Category | % Frequency in 114 Family Scaffolds |
---|---|---|---|
COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 7.89 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 6.14 |
COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 3.51 |
COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.88 |
COG3494 | Uncharacterized conserved protein, DUF1009 family | Function unknown [S] | 0.88 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.09 % |
Unclassified | root | N/A | 14.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10250566 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300004152|Ga0062386_100155260 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300005538|Ga0070731_10901452 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005921|Ga0070766_10163880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1370 | Open in IMG/M |
3300005993|Ga0080027_10058312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans → Syntrophobacter fumaroxidans MPOB | 1405 | Open in IMG/M |
3300006162|Ga0075030_101111364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300006176|Ga0070765_102041810 | Not Available | 536 | Open in IMG/M |
3300006796|Ga0066665_10027261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 3692 | Open in IMG/M |
3300009029|Ga0066793_10691222 | Not Available | 580 | Open in IMG/M |
3300009523|Ga0116221_1094552 | Not Available | 1326 | Open in IMG/M |
3300009624|Ga0116105_1250140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300009635|Ga0116117_1082152 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300009645|Ga0116106_1045258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1479 | Open in IMG/M |
3300009646|Ga0116132_1160189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300009683|Ga0116224_10011753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 4389 | Open in IMG/M |
3300009700|Ga0116217_10842060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300009700|Ga0116217_11030973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300009764|Ga0116134_1222587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300010341|Ga0074045_10082040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2255 | Open in IMG/M |
3300010379|Ga0136449_100816347 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300010379|Ga0136449_102186517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
3300010379|Ga0136449_102382919 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300011271|Ga0137393_10770077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300012206|Ga0137380_11484515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300012356|Ga0137371_10875242 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300012362|Ga0137361_11327312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin018 | 643 | Open in IMG/M |
3300012917|Ga0137395_10450067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
3300012923|Ga0137359_11369965 | Not Available | 595 | Open in IMG/M |
3300012925|Ga0137419_10111471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
3300014169|Ga0181531_10369370 | Not Available | 881 | Open in IMG/M |
3300014491|Ga0182014_10127861 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
3300014499|Ga0182012_10186796 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300014502|Ga0182021_10280991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1956 | Open in IMG/M |
3300014502|Ga0182021_10398421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1633 | Open in IMG/M |
3300014838|Ga0182030_11005241 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300015242|Ga0137412_11089691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300016357|Ga0182032_10327861 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300017929|Ga0187849_1190959 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300017933|Ga0187801_10212854 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300017935|Ga0187848_10471943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300017940|Ga0187853_10033372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2734 | Open in IMG/M |
3300017940|Ga0187853_10364456 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300017946|Ga0187879_10025003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3656 | Open in IMG/M |
3300017966|Ga0187776_10091247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1800 | Open in IMG/M |
3300017972|Ga0187781_10020495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4612 | Open in IMG/M |
3300017975|Ga0187782_10403408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
3300017988|Ga0181520_10398504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 999 | Open in IMG/M |
3300017998|Ga0187870_1282148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300018020|Ga0187861_10105588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
3300018021|Ga0187882_1380599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300018033|Ga0187867_10409259 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300018034|Ga0187863_10055435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2258 | Open in IMG/M |
3300018038|Ga0187855_10145950 | Not Available | 1413 | Open in IMG/M |
3300018038|Ga0187855_10180592 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300018043|Ga0187887_10259862 | Not Available | 1027 | Open in IMG/M |
3300018057|Ga0187858_10696117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300018062|Ga0187784_10111164 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
3300018085|Ga0187772_11054168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300018088|Ga0187771_11283479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300019787|Ga0182031_1451334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1486 | Open in IMG/M |
3300021170|Ga0210400_11304266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300021181|Ga0210388_11414538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300021474|Ga0210390_11334143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300021861|Ga0213853_10705863 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300023255|Ga0224547_1006801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1426 | Open in IMG/M |
3300025454|Ga0208039_1054887 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300025527|Ga0208714_1020499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1617 | Open in IMG/M |
3300026318|Ga0209471_1189484 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300026557|Ga0179587_10241617 | Not Available | 1154 | Open in IMG/M |
3300026557|Ga0179587_10424798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300027334|Ga0209529_1021317 | Not Available | 1099 | Open in IMG/M |
3300027605|Ga0209329_1093930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300027634|Ga0209905_1006116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1448 | Open in IMG/M |
3300027729|Ga0209248_10138105 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300027829|Ga0209773_10237760 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300027862|Ga0209701_10028303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3648 | Open in IMG/M |
3300027862|Ga0209701_10545977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300027869|Ga0209579_10543479 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300027911|Ga0209698_11107269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300028268|Ga0255348_1015342 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
3300028562|Ga0302151_10294107 | Not Available | 539 | Open in IMG/M |
3300028731|Ga0302301_1093475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300028745|Ga0302267_10007116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11109 | Open in IMG/M |
3300028748|Ga0302156_10436213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300028806|Ga0302221_10381021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300029883|Ga0311327_10032836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4260 | Open in IMG/M |
3300029943|Ga0311340_11140453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300029957|Ga0265324_10074778 | Not Available | 1153 | Open in IMG/M |
3300030041|Ga0302274_10111550 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300030044|Ga0302281_10049725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2138 | Open in IMG/M |
3300030054|Ga0302182_10330745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300030399|Ga0311353_10652853 | Not Available | 913 | Open in IMG/M |
3300030507|Ga0302192_10173319 | Not Available | 946 | Open in IMG/M |
3300030688|Ga0311345_10094948 | All Organisms → cellular organisms → Bacteria | 3431 | Open in IMG/M |
3300030707|Ga0310038_10305046 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300031128|Ga0170823_11124299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300031231|Ga0170824_123854203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
3300031242|Ga0265329_10123869 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300031249|Ga0265339_10134920 | Not Available | 1259 | Open in IMG/M |
3300031259|Ga0302187_10120904 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300031521|Ga0311364_10410464 | Not Available | 1373 | Open in IMG/M |
3300031708|Ga0310686_115044678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300031712|Ga0265342_10622453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300031910|Ga0306923_12001695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300032205|Ga0307472_102326608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300033433|Ga0326726_10635009 | Not Available | 1028 | Open in IMG/M |
3300033433|Ga0326726_11554474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 644 | Open in IMG/M |
3300033755|Ga0371489_0037898 | All Organisms → cellular organisms → Bacteria | 3420 | Open in IMG/M |
3300033820|Ga0334817_043323 | Not Available | 892 | Open in IMG/M |
3300033829|Ga0334854_171441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300033983|Ga0371488_0323937 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300034091|Ga0326724_0521929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300034125|Ga0370484_0143004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 640 | Open in IMG/M |
3300034163|Ga0370515_0297912 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.28% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.53% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.89% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 7.02% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.26% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.26% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.39% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.39% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.51% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.51% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.63% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.75% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.75% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.75% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.75% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.75% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.75% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.75% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.88% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.88% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.88% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.88% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028268 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5 | Environmental | Open in IMG/M |
3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_102505661 | 3300001356 | Peatlands Soil | GSANTKQLGGGGVVVEVIVNERAEHARMFAQKSDKTLTVYPY* |
Ga0062386_1001552601 | 3300004152 | Bog Forest Soil | VKSHRIYGSANTKGPFSGGVVVEVIVNERTEHARMFVQKSDKTITVYPY* |
Ga0070731_109014522 | 3300005538 | Surface Soil | FGGGGVIVEVVVNERAEHARMFVQKSDKTITVYPY* |
Ga0070766_101638801 | 3300005921 | Soil | GEWGLVKSHKIYGAANTKGFGGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPF* |
Ga0080027_100583124 | 3300005993 | Prmafrost Soil | IYGSANTKGFGGGGVVVEVILNERAEHARMFVQKPDKTLTVYPY* |
Ga0075030_1011113642 | 3300006162 | Watersheds | SGTFGNAGGTVVEVIVNNRAEHARMFVQKSDNTLTVYPY* |
Ga0070765_1020418101 | 3300006176 | Soil | YGSANTKGFGGGGAVVEVIVNDRAEHARMFVQKSDKTLTVYPY* |
Ga0066665_100272616 | 3300006796 | Soil | EWGLIKSYKIYGSATPKGGGSGVVVEVVVNNRAEHARVWVQKSDKTLSFSPF* |
Ga0066793_106912221 | 3300009029 | Prmafrost Soil | LGRGGVVVEVVVNERSEHARMFVQKSDKTLTVYPF* |
Ga0116221_10945521 | 3300009523 | Peatlands Soil | RIYGSANTKGFGRGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY* |
Ga0116105_12501401 | 3300009624 | Peatland | SANTRNFGGGGVVVEVIVNERSEHARMFVEKSDKTLTVYPY* |
Ga0116117_10821521 | 3300009635 | Peatland | KKFGGGGVVVEVVINERSEHARMFVQKSDKTITVYPF* |
Ga0116106_10452581 | 3300009645 | Peatland | KGFGSGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY* |
Ga0116132_11601892 | 3300009646 | Peatland | ANTKGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY* |
Ga0116224_100117536 | 3300009683 | Peatlands Soil | LGSGGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY* |
Ga0116217_108420602 | 3300009700 | Peatlands Soil | IKSHRIYGSANTKGFGGGGVVVEVIVNDRAEHARMFVQKSDKTLTVYPY* |
Ga0116217_110309732 | 3300009700 | Peatlands Soil | GSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY* |
Ga0116134_12225871 | 3300009764 | Peatland | NTKGLAGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY* |
Ga0074045_100820403 | 3300010341 | Bog Forest Soil | SHKIYGSANTKGFGGGGVVVEVIVNDRAEHARMFVQKSDKTLTVYPY* |
Ga0136449_1008163471 | 3300010379 | Peatlands Soil | KSHRIYGSANTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY* |
Ga0136449_1021865171 | 3300010379 | Peatlands Soil | GLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY* |
Ga0136449_1023829192 | 3300010379 | Peatlands Soil | FGGGVIVEVVVNERAEHARMFVLRSDKTITVYPY* |
Ga0137393_107700771 | 3300011271 | Vadose Zone Soil | LIKSHRIYGSANTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY* |
Ga0137380_114845152 | 3300012206 | Vadose Zone Soil | IYGSASTKGGVVVEVIVNERADRARMFLEKSDKTLTVYPY* |
Ga0137371_108752422 | 3300012356 | Vadose Zone Soil | YGSASTKGGVVVEVIVNERADRARMFLEKSDKTLTVYPY* |
Ga0137361_113273121 | 3300012362 | Vadose Zone Soil | KSHRIYGSANTKGFGSGGVVVEVVVNDRAEHARMFVQKPDKTLTVYPY* |
Ga0137395_104500671 | 3300012917 | Vadose Zone Soil | GEWGLVKSHRIYGSANTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY* |
Ga0137359_113699652 | 3300012923 | Vadose Zone Soil | SANTKGFGSGGVVVEVVVNDRAEHARMFVQKSDKTLTVYPY* |
Ga0137419_101114713 | 3300012925 | Vadose Zone Soil | EWGLIKTHRIYGSANTKGLGSGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY* |
Ga0181531_103693702 | 3300014169 | Bog | EWGLIKSHRVYGSANTKNFGGGGVVVEIIVNERSEHARMFVQRSDKTLTVYPY* |
Ga0182014_101278614 | 3300014491 | Bog | ANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY* |
Ga0182012_101867964 | 3300014499 | Bog | TKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY* |
Ga0182021_102809911 | 3300014502 | Fen | GGEWGLIKSHRIYGSANTKGFTSGGVVVEVIVNERTEHARMFVQRSDKTLTVYPY* |
Ga0182021_103984211 | 3300014502 | Fen | HRVYGSANTKGFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY* |
Ga0182030_110052412 | 3300014838 | Bog | ADTKKFGGGGVIVEVIVNERSEHARMFVQKSDKTITVYPF* |
Ga0137412_110896911 | 3300015242 | Vadose Zone Soil | LVKSHRIYGSASTPRGVVVEVVVNDRADRARMFVEKPDKTLTVYPY* |
Ga0182032_103278611 | 3300016357 | Soil | HRIYGAAGTKGFGSGGGTVVEVIVNERAEHARMFVQKSDKTLTVYPF |
Ga0187849_11909591 | 3300017929 | Peatland | GEWGLVKSHRIYGSANTKGFGGGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY |
Ga0187801_102128542 | 3300017933 | Freshwater Sediment | SFGSGGVIVEVIVNERAEHARMFVQKSDKTITVYPY |
Ga0187848_104719431 | 3300017935 | Peatland | LIKSHRIYGSANTKGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY |
Ga0187853_100333721 | 3300017940 | Peatland | ANTKGFGSGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY |
Ga0187853_103644562 | 3300017940 | Peatland | WGLVKSHRIYGSANTKGFGGGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY |
Ga0187879_100250035 | 3300017946 | Peatland | IYGSANTKGLAGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY |
Ga0187776_100912471 | 3300017966 | Tropical Peatland | RVSGSASIQGGVVVEVVVNDRADRARMFVLKSDKTLTVYPY |
Ga0187781_100204958 | 3300017972 | Tropical Peatland | ANTKGFGGGGVIVEVIVNERAEHARMFVQRSDKTITVYPY |
Ga0187782_104034082 | 3300017975 | Tropical Peatland | ADTKAFSGGGVIVEVVVNERSEHARMFVERSDKTVTVYPY |
Ga0181520_103985041 | 3300017988 | Bog | EWGLIKSHRIYGSANTKGFGGGGVIVEVVVNERTEHARMFVQKSDKTITVYPY |
Ga0187870_12821481 | 3300017998 | Peatland | GSANTKGLGSGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY |
Ga0187861_101055881 | 3300018020 | Peatland | TKGFGSGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY |
Ga0187882_13805991 | 3300018021 | Peatland | NTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY |
Ga0187867_104092591 | 3300018033 | Peatland | KGLAGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY |
Ga0187863_100554351 | 3300018034 | Peatland | WGLIKSHRIYGSANTKGFGGGGVIVEVVVNERTEHARMFVQKSDKTITVYPY |
Ga0187855_101459502 | 3300018038 | Peatland | ANTKGFGGGGVVVEVIVNQRAEHARMFVQKSDKTLTVYPY |
Ga0187855_101805921 | 3300018038 | Peatland | IYGSANTKGFGGGGAVVEVIVNERAEHARMFVQKSDKTLTVYPY |
Ga0187887_102598621 | 3300018043 | Peatland | KSHRIYGSANTKGFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY |
Ga0187858_106961172 | 3300018057 | Peatland | GFGSGGVVVEVVVNERTEHARMFVQRSDKTLTVYPY |
Ga0187784_101111643 | 3300018062 | Tropical Peatland | LIKSFRIYGSADTKAFSGGGVIVEVVVNERSEHARMFVERSDKTVTVYPY |
Ga0187772_110541681 | 3300018085 | Tropical Peatland | KSHRIYGSADTQGFGCGGVIVEVIVNERAEHARMFVQRSDKTITVYPY |
Ga0187771_112834792 | 3300018088 | Tropical Peatland | GGEWGLIKSHRIYGSANTQGLTSGGVIVEVIVNERAEHARMFVQRSDKTITVYPY |
Ga0182031_14513344 | 3300019787 | Bog | LGAGGEWGLIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0210400_113042661 | 3300021170 | Soil | NTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY |
Ga0210388_114145381 | 3300021181 | Soil | HRIYGTANTKNFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY |
Ga0210390_113341431 | 3300021474 | Soil | ANTKNFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY |
Ga0213853_107058631 | 3300021861 | Watersheds | IGNAGGTVVEVIVNERAEHARMFVQKSDKTLTVYPF |
Ga0224547_10068013 | 3300023255 | Soil | KSFGGGGVVVEVIVNERTEHARMFVQRSDKTLTVYPY |
Ga0208039_10548871 | 3300025454 | Peatland | ANTKGFGGGGVVVEVVVNERTEHARMFVQKSDKTLTVYPY |
Ga0208714_10204991 | 3300025527 | Arctic Peat Soil | ANTKSFGGGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY |
Ga0209471_11894842 | 3300026318 | Soil | GLIKSHRIYGSANTKGFGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY |
Ga0179587_102416171 | 3300026557 | Vadose Zone Soil | NTKGFGGGGVVVEVIVNERSEHARMFVQKSDKTLTVYPY |
Ga0179587_104247982 | 3300026557 | Vadose Zone Soil | KGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY |
Ga0209529_10213172 | 3300027334 | Forest Soil | SFGGGGAVVEVIVNERTEHARMFVQKSDKTLTVYPY |
Ga0209329_10939301 | 3300027605 | Forest Soil | GGEWGLVKSHRIYGAANTKGFGGGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY |
Ga0209905_10061163 | 3300027634 | Thawing Permafrost | GGEWGLIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0209248_101381051 | 3300027729 | Bog Forest Soil | TKQLGGGGVIVEVVVNERSEHARMFVQKSDKTLTVYPF |
Ga0209773_102377601 | 3300027829 | Bog Forest Soil | KAFGGGGLVVEVIINERSEHARMFVQKSDKTLTVYPF |
Ga0209701_100283036 | 3300027862 | Vadose Zone Soil | SHRIYGSANTIGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY |
Ga0209701_105459772 | 3300027862 | Vadose Zone Soil | GEWGLIKSHRIYGSANTKGLGSGGVVVEVVVNERAEHARMFVQKSDKTLTVYPY |
Ga0209579_105434791 | 3300027869 | Surface Soil | KGFGGGGVIVEVVVNERAEHARMFVQKSDKTITVYPY |
Ga0209698_111072691 | 3300027911 | Watersheds | IYGSANTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTVYPY |
Ga0255348_10153421 | 3300028268 | Soil | GLIKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0302151_102941071 | 3300028562 | Bog | IKSHSIYGSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0302301_10934752 | 3300028731 | Palsa | ANTKGFGAGGVLVEVIVNERSEHARMFVQRSDKTMTVYPF |
Ga0302267_100071161 | 3300028745 | Bog | SANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0302156_104362131 | 3300028748 | Bog | NTKGFAGGGVVVEVIVNDRSEHARMFVQKSDKTLTVYPY |
Ga0302221_103810212 | 3300028806 | Palsa | HKIYGSANTKGFGAGGAVVEVIVNDRTEHARMFVQKSDKTLTVFPY |
Ga0311327_100328368 | 3300029883 | Bog | SHRIYGTADTKKFGGGGVIVEVIVNERSEHARMFVQKSDKTITVYPF |
Ga0311340_111404532 | 3300029943 | Palsa | GGEWGLIKSHKIYGSANTKGFGAGGAVVEVIVNDRTEHARMFVQKSDKTLTVFPY |
Ga0265324_100747781 | 3300029957 | Rhizosphere | KSYRVYGSANTKGLGGGGVIVEVVVNERAEHARMFVQKTDRTITVYPY |
Ga0302274_101115501 | 3300030041 | Bog | NTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0302281_100497251 | 3300030044 | Fen | GLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0302182_103307451 | 3300030054 | Palsa | GGEWGLVKSHRIYGSANTKGFGAGGVLVEVIVNERSEHARMFVQRSDKTMTVYPF |
Ga0311353_106528532 | 3300030399 | Palsa | GVIKSHKIYGSANTKGFGAGGAVVEVIVNDRTEHARMFVQKSDKTLTVFPY |
Ga0302192_101733192 | 3300030507 | Bog | GTADTKKFGGGGVVVEVVINERSEHARMFVQKSDKTITVYPF |
Ga0311345_100949485 | 3300030688 | Bog | GSANTKGLGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0310038_103050462 | 3300030707 | Peatlands Soil | GGEWGLIKSHRIYGSANTKQLGGGGVVVEVIVNERAEHARMFAQKSDKTLTVYPY |
Ga0170823_111242992 | 3300031128 | Forest Soil | LVKSHRIYGAANTKGFGGGGVVVEVIVNERAEHARMFVQKSDKTLTVYPY |
Ga0170824_1238542031 | 3300031231 | Forest Soil | LIASTARPTRSFGGGGVVVEVIVNERSEHARMFVQKPDKTLTVYPY |
Ga0265329_101238692 | 3300031242 | Rhizosphere | VNTKGFGGGGVVVEIIVNERAEHARMFVQKSDKTLTVYPY |
Ga0265339_101349202 | 3300031249 | Rhizosphere | GGEWGLIKSFHIYGSAATKGLGGGVIVEVVVNERAERARMFVLRSDKTITVYPY |
Ga0302187_101209044 | 3300031259 | Bog | LGGGGVVVEVIVNERAEHARMFVEKADKTLTVYPY |
Ga0311364_104104643 | 3300031521 | Fen | HRIYGSANTKGLMSGGVIVEVIVNERAEHARMFVQKSDKTITVYPY |
Ga0310686_1150446781 | 3300031708 | Soil | GSANTKNFGGGGVVVEVIVNERAEHARMFVDKSNKTLTVYPY |
Ga0265342_106224532 | 3300031712 | Rhizosphere | GLGGGGVIVEVVVNERAEHARMFVQKTDRTITVYPY |
Ga0306923_120016952 | 3300031910 | Soil | GGGSGVVVEVEVNQRAEHARVWVQKSDKTMTFSPY |
Ga0307472_1023266081 | 3300032205 | Hardwood Forest Soil | WGLIKSYRIYGSANTKGFGRGGVIVEVIVNERSEHARMFVQKPDKTLTVYPF |
Ga0326726_106350091 | 3300033433 | Peat Soil | HRIYGSAGTKSFGSGTIGNAGGTVVEVIVNNRAEHARMFVQKTDKTLTVYPF |
Ga0326726_115544741 | 3300033433 | Peat Soil | GEWGLIKQHRIYGSVATKGGVVVEVIVNDRADRARMFVQKADKTLTVYPY |
Ga0371489_0037898_1_162 | 3300033755 | Peat Soil | EWGLIKSHRIYGSANTKGFTGGGVVVEVIVNERTEHARMFVQKSDKTLTVYPY |
Ga0334817_043323_761_892 | 3300033820 | Soil | YGSANTKSFGGGGVVVEVVVNERSEHERMFLQRSDKTLTVWPY |
Ga0334854_171441_11_163 | 3300033829 | Soil | LIKSHKIYGSANTKNFGGGGVVVEVIINERSEHARMFVEKSDKTLTVYPY |
Ga0371488_0323937_589_729 | 3300033983 | Peat Soil | SFRIYGSANTKGFGGGVIVEVVVNNRAEHARMFVTRSDKTVTVYPY |
Ga0326724_0521929_437_604 | 3300034091 | Peat Soil | GGEWGLIKSHRIYGSANTKGFTGGGVVVEVIVNERTEHARMFVQKSDKTLTVYPY |
Ga0370484_0143004_452_640 | 3300034125 | Untreated Peat Soil | FYRDWGPGSEWGLIKSHRIYGSANTKGFGSGGVVVEVVVNERSEHARMFVQKSDKTLTLYPY |
Ga0370515_0297912_569_682 | 3300034163 | Untreated Peat Soil | KNFGGGGVVVEIIVNERSEHARMFVQRSDKTLTVYPY |
⦗Top⦘ |