NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F081057

Metagenome Family F081057

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F081057
Family Type Metagenome
Number of Sequences 114
Average Sequence Length 42 residues
Representative Sequence FTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Number of Associated Samples 105
Number of Associated Scaffolds 114

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 1.75 %
% of genes near scaffold ends (potentially truncated) 93.86 %
% of genes from short scaffolds (< 2000 bps) 89.47 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.877 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(20.175 % of family members)
Environment Ontology (ENVO) Unclassified
(25.439 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.123 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.84%    β-sheet: 0.00%    Coil/Unstructured: 67.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 114 Family Scaffolds
PF10099RskA 6.14
PF01548DEDD_Tnp_IS110 2.63
PF02371Transposase_20 1.75
PF01565FAD_binding_4 1.75
PF13538UvrD_C_2 1.75
PF08002DUF1697 0.88
PF13419HAD_2 0.88
PF13700DUF4158 0.88
PF13424TPR_12 0.88
PF17032zinc_ribbon_15 0.88
PF13683rve_3 0.88
PF00069Pkinase 0.88
PF02817E3_binding 0.88
PF12697Abhydrolase_6 0.88
PF00361Proton_antipo_M 0.88
PF14667Polysacc_synt_C 0.88
PF10686YAcAr 0.88
PF01527HTH_Tnp_1 0.88
PF05103DivIVA 0.88
PF00296Bac_luciferase 0.88
PF03160Calx-beta 0.88
PF12900Pyridox_ox_2 0.88
PF13671AAA_33 0.88
PF01850PIN 0.88
PF00589Phage_integrase 0.88
PF13006Nterm_IS4 0.88
PF00872Transposase_mut 0.88
PF00392GntR 0.88
PF01494FAD_binding_3 0.88
PF09586YfhO 0.88
PF00903Glyoxalase 0.88
PF00583Acetyltransf_1 0.88
PF13359DDE_Tnp_4 0.88
PF02567PhzC-PhzF 0.88

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 114 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 4.39
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.51
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.75
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.88
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.88
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.88
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.88
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.88
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.88
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.88
COG3797Uncharacterized conserved protein, DUF1697 familyFunction unknown [S] 0.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A50.88 %
All OrganismsrootAll Organisms49.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B01AR1Q1All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata obscuriglobus500Open in IMG/M
3300004268|Ga0066398_10002753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1901Open in IMG/M
3300004479|Ga0062595_102690787Not Available501Open in IMG/M
3300004633|Ga0066395_10301689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis balhimycina876Open in IMG/M
3300005186|Ga0066676_10227729Not Available1209Open in IMG/M
3300005435|Ga0070714_100445239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1230Open in IMG/M
3300005436|Ga0070713_101968801Not Available567Open in IMG/M
3300005439|Ga0070711_101661818Not Available559Open in IMG/M
3300005518|Ga0070699_101132160Not Available718Open in IMG/M
3300005540|Ga0066697_10639210Not Available587Open in IMG/M
3300005602|Ga0070762_10302311Not Available1008Open in IMG/M
3300005713|Ga0066905_101277379Not Available659Open in IMG/M
3300006804|Ga0079221_10189674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1116Open in IMG/M
3300006903|Ga0075426_10658522Not Available784Open in IMG/M
3300006954|Ga0079219_12109553Not Available540Open in IMG/M
3300009038|Ga0099829_10496250All Organisms → cellular organisms → Bacteria → Terrabacteria group1013Open in IMG/M
3300009094|Ga0111539_11108431Not Available920Open in IMG/M
3300009101|Ga0105247_10379393Not Available1002Open in IMG/M
3300009683|Ga0116224_10380760Not Available671Open in IMG/M
3300010048|Ga0126373_13082500Not Available519Open in IMG/M
3300010333|Ga0134080_10625016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300010341|Ga0074045_10349679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria964Open in IMG/M
3300010358|Ga0126370_10451016All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300010359|Ga0126376_10288030All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300010360|Ga0126372_13219526Not Available507Open in IMG/M
3300010361|Ga0126378_10808380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1047Open in IMG/M
3300010361|Ga0126378_12857645Not Available551Open in IMG/M
3300010398|Ga0126383_10517377All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300010398|Ga0126383_11749374Not Available710Open in IMG/M
3300010398|Ga0126383_12345583Not Available619Open in IMG/M
3300012198|Ga0137364_10103753All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300012199|Ga0137383_11208955Not Available543Open in IMG/M
3300012201|Ga0137365_10414224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. PSKA30994Open in IMG/M
3300012208|Ga0137376_11421534Not Available584Open in IMG/M
3300012210|Ga0137378_10623761Not Available988Open in IMG/M
3300012211|Ga0137377_10667303Not Available975Open in IMG/M
3300012211|Ga0137377_11078519Not Available733Open in IMG/M
3300012360|Ga0137375_10236970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1696Open in IMG/M
3300012363|Ga0137390_10467827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → unclassified Bacillus (in: Bacteria) → Bacillus sp. AZ431236Open in IMG/M
3300012917|Ga0137395_10980560Not Available607Open in IMG/M
3300012917|Ga0137395_11294683Not Available504Open in IMG/M
3300012922|Ga0137394_10794772Not Available793Open in IMG/M
3300012971|Ga0126369_13511298Not Available514Open in IMG/M
3300012971|Ga0126369_13564095Not Available510Open in IMG/M
3300014166|Ga0134079_10096321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1123Open in IMG/M
3300014493|Ga0182016_10437465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. IgraMP-1767Open in IMG/M
3300015373|Ga0132257_102086675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium732Open in IMG/M
3300016270|Ga0182036_10627394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia864Open in IMG/M
3300016341|Ga0182035_11739105Not Available564Open in IMG/M
3300016387|Ga0182040_11558336Not Available562Open in IMG/M
3300016445|Ga0182038_11000204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300016445|Ga0182038_11702711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300017822|Ga0187802_10031209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1891Open in IMG/M
3300017926|Ga0187807_1004781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4150Open in IMG/M
3300017927|Ga0187824_10367382All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300017932|Ga0187814_10072059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1267Open in IMG/M
3300017946|Ga0187879_10793906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae528Open in IMG/M
3300017959|Ga0187779_10317488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1000Open in IMG/M
3300017993|Ga0187823_10125740All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300017995|Ga0187816_10158329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia981Open in IMG/M
3300018001|Ga0187815_10093470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1267Open in IMG/M
3300018007|Ga0187805_10207536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300018085|Ga0187772_10997370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces glauciniger612Open in IMG/M
3300021404|Ga0210389_10031545Not Available4072Open in IMG/M
3300021439|Ga0213879_10120666Not Available746Open in IMG/M
3300021474|Ga0210390_10883120Not Available736Open in IMG/M
3300021477|Ga0210398_10153974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1871Open in IMG/M
3300021560|Ga0126371_10054074All Organisms → cellular organisms → Bacteria3850Open in IMG/M
3300025527|Ga0208714_1018655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1714Open in IMG/M
3300025527|Ga0208714_1033989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani1176Open in IMG/M
3300025906|Ga0207699_10082873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1993Open in IMG/M
3300025917|Ga0207660_10634972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii870Open in IMG/M
3300025922|Ga0207646_10019207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6354Open in IMG/M
3300025981|Ga0207640_12058476Not Available517Open in IMG/M
3300026291|Ga0209890_10017875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2789Open in IMG/M
3300027775|Ga0209177_10003676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter3006Open in IMG/M
3300027874|Ga0209465_10646150Not Available521Open in IMG/M
3300027908|Ga0209006_11074920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300028742|Ga0302220_10028079Not Available2562Open in IMG/M
3300028773|Ga0302234_10323858Not Available661Open in IMG/M
3300028773|Ga0302234_10347944All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300028787|Ga0307323_10383709All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter503Open in IMG/M
3300028793|Ga0307299_10391317Not Available521Open in IMG/M
3300028828|Ga0307312_10028448All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300028871|Ga0302230_10280899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia645Open in IMG/M
3300029944|Ga0311352_10335466Not Available1252Open in IMG/M
3300030399|Ga0311353_10901115Not Available747Open in IMG/M
3300031027|Ga0302308_10743210All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300031546|Ga0318538_10150683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1229Open in IMG/M
3300031561|Ga0318528_10238653All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300031564|Ga0318573_10710436Not Available540Open in IMG/M
3300031572|Ga0318515_10766637Not Available509Open in IMG/M
3300031720|Ga0307469_12116267Not Available547Open in IMG/M
3300031747|Ga0318502_10535543Not Available703Open in IMG/M
3300031751|Ga0318494_10333365Not Available877Open in IMG/M
3300031765|Ga0318554_10628522Not Available604Open in IMG/M
3300031768|Ga0318509_10169593Not Available1209Open in IMG/M
3300031770|Ga0318521_10213438Not Available1118Open in IMG/M
3300031779|Ga0318566_10458693Not Available625Open in IMG/M
3300031805|Ga0318497_10453552Not Available718Open in IMG/M
3300031819|Ga0318568_10909712Not Available544Open in IMG/M
3300031860|Ga0318495_10147285Not Available1062Open in IMG/M
3300031879|Ga0306919_11539049Not Available500Open in IMG/M
3300031910|Ga0306923_11535987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300031946|Ga0310910_11494016Not Available518Open in IMG/M
3300031954|Ga0306926_12567657Not Available557Open in IMG/M
3300032010|Ga0318569_10025073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2439Open in IMG/M
3300032041|Ga0318549_10324804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300032044|Ga0318558_10409145Not Available675Open in IMG/M
3300032064|Ga0318510_10053163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1439Open in IMG/M
3300032067|Ga0318524_10751873Not Available515Open in IMG/M
3300032090|Ga0318518_10618944Not Available552Open in IMG/M
3300032261|Ga0306920_100248268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2655Open in IMG/M
3300033134|Ga0335073_10172107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2719Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.40%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.02%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.88%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.88%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.88%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.88%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.88%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.88%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_042521502170459023Grass SoilSDTDTRFRDLGPDWHDRLNPQRRARSLRHELERLTGQKVTLTPATGAPAA
Ga0066398_1000275313300004268Tropical Forest SoilAHFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVLLQEAA*
Ga0062595_10269078713300004479SoilPGARFTDLGPGWHDRLTPLRRRRQLIAELERLSGQKVILQEAA*
Ga0066395_1030168923300004633Tropical Forest SoilFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVLLQEEAA*
Ga0066676_1022772943300005186SoilFADLGPDWHDRIAPLRRKRQLIAELERLSGKKVTLQEAAA*
Ga0070714_10044523933300005435Agricultural SoilDPAAHFTDLGPGWHDRLAPQRRKRQLITELERLSGQKVTLTSAT*
Ga0070713_10196880123300005436Corn, Switchgrass And Miscanthus RhizosphereLFTVAAATGSDWHDRIASLRRKRQLIAELERLSGKKVLLQETAA*
Ga0070711_10166181813300005439Corn, Switchgrass And Miscanthus RhizosphereARFTDLGPNWHDRITPIRRKRQLIAEPERLSGRKVLLQEEAAT*
Ga0070699_10113216013300005518Corn, Switchgrass And Miscanthus RhizosphereSDPGTRFTDLGPYWHDHLAPLRRKRQLIAELERLSGMKVTLQQPA*
Ga0066697_1063921023300005540SoilFTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVLLQQETAA*
Ga0070762_1030231123300005602SoilTDLGPDWHDRLTPLRRKHHLIAELERLSGKKVTLHDAS*
Ga0066905_10127737933300005713Tropical Forest SoilGPDWHDRLAPLRRKRQLVAELERLSGKKVVLQEAAA*
Ga0079221_1018967413300006804Agricultural SoilLLSDPGARFTDLGPDWPDRLAPIRRKRQLIAELERLSGKKVVLQEEAAA*
Ga0075426_1065852223300006903Populus RhizosphereFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA*
Ga0079219_1210955313300006954Agricultural SoilAAHFTDLGPYWHDRIAPLRRKRQLIAELERLSGKKVLLEDAAA*
Ga0099829_1049625023300009038Vadose Zone SoilDLGPDWHDRLAPQRRKRQLITELERLSGQKVTLTNAA*
Ga0111539_1110843113300009094Populus RhizosphereDLGVDFHDRLHPQRRTHQLIRELEHLSGKKVTLHTAA*
Ga0105247_1037939323300009101Switchgrass RhizospherePAAHFTDLGPGWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA*
Ga0116224_1038076013300009683Peatlands SoilGAHFTDLGPDWHDRIAPQRRKHQLIAELERLSGKKVTLNDAA*
Ga0126373_1308250013300010048Tropical Forest SoilRFTDLGPTWHDHLAPLRRKRQLIAELERLSGMKVTLQQSA*
Ga0134080_1062501613300010333Grasslands SoilTDLGPDWHDRIAPLRRKRQLIAELERLSGKKVLLQQETAA*
Ga0074045_1034967923300010341Bog Forest SoilFTDLGPGWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA*
Ga0126370_1045101633300010358Tropical Forest SoilFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA*
Ga0126376_1028803013300010359Tropical Forest SoilDLGPDWHDRLAPQRRKRQLIAELERLSGKKITLNDAA*
Ga0126372_1321952613300010360Tropical Forest SoilLGPDWHDRIAPIRRKRQLIAELERLSGKKVLLQEEAA*
Ga0126378_1080838013300010361Tropical Forest SoilPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAV*
Ga0126378_1285764533300010361Tropical Forest SoilDAHFSDLGPYWHDRIAPLRRKRQLIAKLERLSGKKVLLHDATT*
Ga0126383_1051737723300010398Tropical Forest SoilFTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVLLQEATA*
Ga0126383_1174937423300010398Tropical Forest SoilFTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVTLNDAA*
Ga0126383_1234558313300010398Tropical Forest SoilHRLLSDPAAHFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVLLQEAA*
Ga0137364_1010375313300012198Vadose Zone SoilFTDLGPDWHDRLVPQRRKRQLLAELERLSGKKVTLHDAA*
Ga0137383_1120895523300012199Vadose Zone SoilDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA*
Ga0137365_1041422433300012201Vadose Zone SoilGPDWHDRLAPLRRKRQLIAELERISGKKVTLHDAA*
Ga0137376_1142153413300012208Vadose Zone SoilLSDPGAHFTDLGPDWHDRLAPQRRKRQLIAELERLSGKKVTLNDAA*
Ga0137378_1062376123300012210Vadose Zone SoilFTDLGPDWHDRLAPQRRKRQLITELERLSGQKVTLTNAA*
Ga0137377_1066730313300012211Vadose Zone SoilGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA*
Ga0137377_1107851913300012211Vadose Zone SoilFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLQHTV*
Ga0137375_1023697033300012360Vadose Zone SoilPAARFTDLGPDWHDRLAPLRPKRQLIAELERISGKKVTLHDAA*
Ga0137390_1046782723300012363Vadose Zone SoilGPDWHDRLAPQRRKHQLIAELERLSGKKVTLHDAA*
Ga0137395_1098056013300012917Vadose Zone SoilRFTDLGPYWHDHLAPLRCKRQLIAELERLSGMKVTLQQSA*
Ga0137395_1129468313300012917Vadose Zone SoilHFTDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLHDAA*
Ga0137394_1079477213300012922Vadose Zone SoilPAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLNDAA*
Ga0126369_1351129813300012971Tropical Forest SoilRFADLGPTWHDRLTPQRRKRQLIAELERLSGMKVTLQEAA*
Ga0126369_1356409523300012971Tropical Forest SoilLSGPDARFAGLGPHWHDRIAPLRRKRQLIAELERLSGKKVILQEAAA*
Ga0134079_1009632123300014166Grasslands SoilDLGPDWHDRIAPLRRKRQLIAELERLSGKKVLLQEETAA*
Ga0182016_1043746513300014493BogTDLGPDWHDRLAPLRRKHQLIAELERLSGKKVTLHDGA*
Ga0132257_10208667523300015373Arabidopsis RhizosphereRFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA*
Ga0182036_1062739423300016270SoilFADLGPDWHDRLAPLRRKRQLVVKLERLSGKKVLLQEAA
Ga0182035_1173910513300016341SoilAAHFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Ga0182040_1155833613300016387SoilDFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAV
Ga0182038_1100020433300016445SoilARFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLNDAA
Ga0182038_1170271113300016445SoilPAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTFHDAA
Ga0187802_1003120913300017822Freshwater SedimentDPAAHFTDLGPDWHDRLAPLRRKRQLIAEIERLTGKKVTLHDAA
Ga0187807_100478173300017926Freshwater SedimentFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA
Ga0187824_1036738213300017927Freshwater SedimentTDLGPGWHDRLAPLRRKRQLIAELERLSGKKVTLQDAI
Ga0187814_1007205913300017932Freshwater SedimentPAAHFTDLGPDWHDRLAPLRRKRQLIAEIERLTGKKVTLHDAA
Ga0187879_1079390623300017946PeatlandGPGWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA
Ga0187779_1031748823300017959Tropical PeatlandGPDWHDRIAPLRRKRQLIAELERMSGKKVLLQDAA
Ga0187823_1012574023300017993Freshwater SedimentAHFTDLGPDWHDKIAPIRRKRQLIAELERLSGKKVLLQEETAA
Ga0187816_1015832913300017995Freshwater SedimentAAHFTDLGPDWHDRLAPLRRKRQLIAEIERLTGKKVTLHDAA
Ga0187815_1009347013300018001Freshwater SedimentPAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Ga0187805_1020753633300018007Freshwater SedimentFADLGPDWHDRLAPLRRERQLIAELERLSGKKVLLQEAA
Ga0187772_1099737013300018085Tropical PeatlandARFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQEAAA
Ga0210389_1003154513300021404SoilHFTDLGPDWHDRLTPLRRKHHLIAELERLSGKKVTLHDAS
Ga0213879_1012066613300021439Bulk SoilVWLLADVGARFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQEAAA
Ga0210390_1088312033300021474SoilQLSDPDSRFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA
Ga0210398_1015397413300021477SoilSDPDSRFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVLLQEAA
Ga0126371_1005407413300021560Tropical Forest SoilDPDAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQDDAA
Ga0208714_101865533300025527Arctic Peat SoilDTSGRLGPDWHDRLTPIRRKRQLIAELERLSGKKVLLKEEAA
Ga0208714_103398913300025527Arctic Peat SoilMTWTRFSAPTRFTDLGSDWHDRLTPIRRKRQLITELERLSGKKVVLQDEAA
Ga0207699_1008287323300025906Corn, Switchgrass And Miscanthus RhizosphereGPHWHDRIAPLRRKRQLIAELERLSGKKVLLQEGAA
Ga0207660_1063497213300025917Corn RhizospherePDWHDRIAPLRRKRQLITELERLSGKKVQLQEAAA
Ga0207646_1001920713300025922Corn, Switchgrass And Miscanthus RhizosphereGPDWHARLAPLRRKRQLIAELERLSGKKVTLQDTV
Ga0207640_1205847613300025981Corn RhizosphereDLAPGWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Ga0209890_1001787513300026291SoilGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA
Ga0209177_1000367613300027775Agricultural SoilMGPDWHDRLAPLRRKRHFIAELERLSGKKVTLHDAA
Ga0209465_1064615023300027874Tropical Forest SoilRFTDLGPTWHDHLAPLRRKRQLIAELERLSGMKVTLHQTG
Ga0209006_1107492023300027908Forest SoilLSDPAAHFTDLGPDWHDRLTPLRRKHHLIAELERLSGKKVTLHDAS
Ga0302220_1002807923300028742PalsaDPEARFADLGPDWHDRIAPLRRKRQLIAGLGQRMSGKKVLLQEAAV
Ga0302234_1032385813300028773PalsaDLGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA
Ga0302234_1034794413300028773PalsaLSDAAAHFTDLGRDWHDRLAPLRRKRQLIAELERLSGKKVTLNDAA
Ga0307323_1038370913300028787SoilHFTDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA
Ga0307299_1039131713300028793SoilPGAHFTDLGPDWHDRLAPQRRKHQLIAELERLSGKKVTLNDAA
Ga0307312_1002844843300028828SoilGPDWHDRLAPLRRKRQLIAELERLSGKKVTLNDAA
Ga0302230_1028089913300028871PalsaPDARFTDLGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEAAA
Ga0311352_1033546623300029944PalsaDAHFTDLGPGWHDRLAPLRPKRQLVAELERLSGKKVLLQEATA
Ga0311353_1090111513300030399PalsaFTDLGPNWHDRLAPLRRKRQLVAELERLSGKKVLLQEATA
Ga0302308_1074321023300031027PalsaDPAAAFTDLGPDWYDRLSPLRRKRQLIAELERLSGKKVLLQEAAA
Ga0318538_1015068323300031546SoilGSDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAT
Ga0318528_1023865313300031561SoilDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Ga0318573_1071043613300031564SoilLSDPGTRFTDLGPYWHDHLAPLRRKRQLIAELERLSGMKVTLQQSA
Ga0318515_1076663723300031572SoilVGPDARFADLGPDWHDRIAPLRRKRQLIAELERLSGKKVTLQEAAA
Ga0307469_1211626713300031720Hardwood Forest SoilAAHFTDLGPGWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Ga0318502_1053554313300031747SoilDDARPGNTHLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0318494_1033336523300031751SoilVRGYDDARPGNTHLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0318554_1062852223300031765SoilLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0318509_1016959323300031768SoilEARFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLQDAAA
Ga0318521_1021343823300031770SoilVRGYYDARPGNTDLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0318566_1045869313300031779SoilARFADPGPDWHDRIAPLHRKRQLIAELERLSGKKVTLQEAAA
Ga0318497_1045355223300031805SoilYYDARPGNTDLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0318568_1090971213300031819SoilARFTDLGPDWHDRLAPVRRKRQLIAELERLSGKKVTLQEAAA
Ga0318495_1014728523300031860SoilVRGYDDARPGNTDLGPDWHGRLSPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0306919_1153904913300031879SoilSDPAAHFTDLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLQDTV
Ga0306923_1153598723300031910SoilDPAARFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVTLNDAA
Ga0310910_1149401623300031946SoilIAHRLLSDPGTRFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVVLQESAA
Ga0306926_1256765713300031954SoilDPGPDWHDRIAPLHRKRQLIAELERLSGKKVTLQEAAA
Ga0318569_1002507353300032010SoilGARFADLGPTWHDRLTPQRRKRQLIAELERLSGMKVTLEAA
Ga0318549_1032480413300032041SoilFTDLGPDWHDRLAPIRRKRQLIAELERLSGKKVLLQEAAA
Ga0318558_1040914523300032044SoilRLLSDPGTRFSDLGPDWHDRIAPLRRKRQLIAELERLSGRKVLLQDAAA
Ga0318510_1005316313300032064SoilLLSDPDAHFTDLGPYWHDRIAPLRRKRQLIAELERLSGKKVLLEDAAA
Ga0318524_1075187313300032067SoilFSDLGPDWHDRIAPLRRKRQLIAELERLSGKKVLLQDAAA
Ga0318518_1061894413300032090SoilLLSDPAAHFADLGPDWHDRLAPLRRKRQLIAELERLSGKKVTLHDAA
Ga0306920_10024826843300032261SoilVRGYDDARPGNTDLGPDWHGRLAPLRRKRQLIAKLERLSGIKVNLQESAA
Ga0335073_1017210743300033134SoilLTDLGPDWHDRIAPIRRKRQLIAELERLSGKKVLLHEEAAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.