NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080525

Metagenome / Metatranscriptome Family F080525

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080525
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 69 residues
Representative Sequence MKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Number of Associated Samples 105
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 31.30 %
% of genes near scaffold ends (potentially truncated) 53.04 %
% of genes from short scaffolds (< 2000 bps) 78.26 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.826 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(23.478 % of family members)
Environment Ontology (ENVO) Unclassified
(51.304 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.435 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 67.19%    β-sheet: 0.00%    Coil/Unstructured: 32.81%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF08804gp32 22.61
PF08993T4_Gp59_N 6.09
PF01126Heme_oxygenase 1.74
PF05728UPF0227 0.87
PF07486Hydrolase_2 0.87
PF11246Phage_gp53 0.87
PF12322T4_baseplate 0.87
PF03382DUF285 0.87
PF08406CbbQ_C 0.87
PF05226CHASE2 0.87
PF05996Fe_bilin_red 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3230Heme oxygenaseInorganic ion transport and metabolism [P] 1.74
COG5398Heme oxygenaseCoenzyme transport and metabolism [H] 1.74
COG0714MoxR-like ATPaseGeneral function prediction only [R] 0.87
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 0.87
COG4252Extracytoplasmic sensor domain CHASE2 (specificity unknown)Signal transduction mechanisms [T] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.65 %
UnclassifiedrootN/A4.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10001252All Organisms → cellular organisms → Bacteria20723Open in IMG/M
3300000224|SI34jun09_10mDRAFT_1003694All Organisms → Viruses → Predicted Viral4163Open in IMG/M
3300000928|OpTDRAFT_10024960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED522985Open in IMG/M
3300003216|JGI26079J46598_1008589All Organisms → Viruses → Predicted Viral3190Open in IMG/M
3300003410|JGI26086J50260_1008227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED524244Open in IMG/M
3300003620|JGI26273J51734_10193764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52514Open in IMG/M
3300005837|Ga0078893_10428294All Organisms → Viruses → Predicted Viral2758Open in IMG/M
3300005837|Ga0078893_11711800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52542Open in IMG/M
3300006164|Ga0075441_10011902All Organisms → Viruses → Predicted Viral3681Open in IMG/M
3300006191|Ga0075447_10057237All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300006352|Ga0075448_10203714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae605Open in IMG/M
3300006382|Ga0075494_1189816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae847Open in IMG/M
3300006793|Ga0098055_1002309All Organisms → cellular organisms → Bacteria → Proteobacteria9938Open in IMG/M
3300006802|Ga0070749_10439962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52715Open in IMG/M
3300006922|Ga0098045_1030269All Organisms → Viruses → Predicted Viral1397Open in IMG/M
3300006924|Ga0098051_1063585All Organisms → Viruses → Predicted Viral1009Open in IMG/M
3300007229|Ga0075468_10025129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED522163Open in IMG/M
3300007538|Ga0099851_1248942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52636Open in IMG/M
3300007540|Ga0099847_1215602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52557Open in IMG/M
3300007549|Ga0102879_1145869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52725Open in IMG/M
3300007625|Ga0102870_1098369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52854Open in IMG/M
3300007627|Ga0102869_1092492All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium829Open in IMG/M
3300009001|Ga0102963_1368722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52563Open in IMG/M
3300009086|Ga0102812_10152471All Organisms → Viruses → Predicted Viral1264Open in IMG/M
3300009172|Ga0114995_10019056Not Available4137Open in IMG/M
3300009172|Ga0114995_10106492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1572Open in IMG/M
3300009419|Ga0114982_1036125All Organisms → Viruses → Predicted Viral1592Open in IMG/M
3300009420|Ga0114994_10454589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52845Open in IMG/M
3300009420|Ga0114994_10568896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52744Open in IMG/M
3300009420|Ga0114994_10744153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52638Open in IMG/M
3300009436|Ga0115008_10141190All Organisms → cellular organisms → Bacteria1759Open in IMG/M
3300009592|Ga0115101_1462787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52794Open in IMG/M
3300009599|Ga0115103_1066112All Organisms → Viruses → Predicted Viral1964Open in IMG/M
3300009677|Ga0115104_10337845All Organisms → Viruses → Predicted Viral1700Open in IMG/M
3300010316|Ga0136655_1000382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria19769Open in IMG/M
3300010316|Ga0136655_1002297Not Available8253Open in IMG/M
3300010368|Ga0129324_10004442Not Available8129Open in IMG/M
3300012522|Ga0129326_1220453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52749Open in IMG/M
3300016733|Ga0182042_1396599All Organisms → Viruses → Predicted Viral1787Open in IMG/M
3300016734|Ga0182092_1134007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521147Open in IMG/M
3300016736|Ga0182049_1266952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52644Open in IMG/M
3300016739|Ga0182076_1274305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52530Open in IMG/M
3300016740|Ga0182096_1373329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52565Open in IMG/M
3300016776|Ga0182046_1497196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52689Open in IMG/M
3300017697|Ga0180120_10233324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52752Open in IMG/M
3300017713|Ga0181391_1033749All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300017719|Ga0181390_1018886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED522279Open in IMG/M
3300017762|Ga0181422_1139272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52747Open in IMG/M
3300017782|Ga0181380_1234402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52611Open in IMG/M
3300018036|Ga0181600_10283245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52841Open in IMG/M
3300018413|Ga0181560_10141144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521227Open in IMG/M
3300020014|Ga0182044_1008122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52852Open in IMG/M
3300020165|Ga0206125_10008220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7933Open in IMG/M
3300020347|Ga0211504_1024689All Organisms → Viruses → Predicted Viral1568Open in IMG/M
3300020438|Ga0211576_10316475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52809Open in IMG/M
3300021085|Ga0206677_10005461All Organisms → cellular organisms → Bacteria → Proteobacteria10005Open in IMG/M
3300021085|Ga0206677_10115782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521242Open in IMG/M
3300021185|Ga0206682_10071384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521805Open in IMG/M
3300021365|Ga0206123_10101015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521378Open in IMG/M
3300021378|Ga0213861_10121317All Organisms → Viruses → Predicted Viral1525Open in IMG/M
3300021960|Ga0222715_10406536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52743Open in IMG/M
3300021964|Ga0222719_10121039All Organisms → Viruses → Predicted Viral1885Open in IMG/M
3300022061|Ga0212023_1000364All Organisms → Viruses → Predicted Viral3680Open in IMG/M
3300022200|Ga0196901_1031920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED522050Open in IMG/M
(restricted) 3300023109|Ga0233432_10006719All Organisms → cellular organisms → Bacteria → Proteobacteria9766Open in IMG/M
(restricted) 3300023109|Ga0233432_10082134All Organisms → Viruses → Predicted Viral1877Open in IMG/M
3300023568|Ga0228696_1035347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52571Open in IMG/M
3300023698|Ga0228682_1058290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52522Open in IMG/M
3300023702|Ga0232119_1065595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52543Open in IMG/M
3300024180|Ga0228668_1101417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52510Open in IMG/M
3300024221|Ga0228666_1054228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52820Open in IMG/M
3300024231|Ga0233399_1131241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52548Open in IMG/M
(restricted) 3300024264|Ga0233444_10028243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED523760Open in IMG/M
3300024281|Ga0228610_1050856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52580Open in IMG/M
3300024319|Ga0228670_1074414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52719Open in IMG/M
3300024326|Ga0228652_1048309All Organisms → Viruses → Predicted Viral1112Open in IMG/M
3300024329|Ga0228631_1117961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52611Open in IMG/M
3300025070|Ga0208667_1047862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52700Open in IMG/M
3300025276|Ga0208814_1000539Not Available22518Open in IMG/M
3300025543|Ga0208303_1030755All Organisms → Viruses → Predicted Viral1430Open in IMG/M
3300025608|Ga0209654_1113028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52707Open in IMG/M
3300025770|Ga0209362_1258092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52561Open in IMG/M
3300025849|Ga0209603_1006721All Organisms → cellular organisms → Bacteria8952Open in IMG/M
3300025870|Ga0209666_1068839All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300026420|Ga0247581_1069979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52560Open in IMG/M
3300026437|Ga0247577_1040252All Organisms → Viruses → Predicted Viral1046Open in IMG/M
3300026443|Ga0247559_1111634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52561Open in IMG/M
3300026447|Ga0247607_1067624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52628Open in IMG/M
3300026448|Ga0247594_1046709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52742Open in IMG/M
3300026462|Ga0247568_1016509All Organisms → Viruses → Predicted Viral1363Open in IMG/M
3300026470|Ga0247599_1085853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52660Open in IMG/M
3300026471|Ga0247602_1059779All Organisms → Viruses → Predicted Viral1052Open in IMG/M
3300026500|Ga0247592_1073088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52834Open in IMG/M
3300026503|Ga0247605_1091776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52744Open in IMG/M
3300026513|Ga0247590_1049035All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300027081|Ga0208954_1034319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52663Open in IMG/M
3300027198|Ga0208163_1021441All Organisms → Viruses → Predicted Viral1091Open in IMG/M
3300027248|Ga0208176_1010810All Organisms → Viruses → Predicted Viral1277Open in IMG/M
3300027253|Ga0208680_1048977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52778Open in IMG/M
3300027687|Ga0209710_1001011Not Available22773Open in IMG/M
3300027710|Ga0209599_10026883All Organisms → Viruses → Predicted Viral1586Open in IMG/M
3300027788|Ga0209711_10037525All Organisms → cellular organisms → Bacteria → Proteobacteria2781Open in IMG/M
3300027788|Ga0209711_10365126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52603Open in IMG/M
3300027810|Ga0209302_10165085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521076Open in IMG/M
3300028008|Ga0228674_1051132All Organisms → Viruses → Predicted Viral1563Open in IMG/M
3300028115|Ga0233450_10258275All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300028129|Ga0228634_1060926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52925Open in IMG/M
3300028130|Ga0228619_1092340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52736Open in IMG/M
3300028282|Ga0256413_1030190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1785Open in IMG/M
3300028282|Ga0256413_1203936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52709Open in IMG/M
3300031519|Ga0307488_10076736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED522497Open in IMG/M
3300031519|Ga0307488_10189194All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300031599|Ga0308007_10086428All Organisms → Viruses1161Open in IMG/M
3300031721|Ga0308013_10126670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52984Open in IMG/M
3300031851|Ga0315320_10446785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52884Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater23.48%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.17%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.70%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine6.96%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.09%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.48%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater3.48%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.48%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.61%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water1.74%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.74%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.74%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.74%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.87%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.87%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.87%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000224Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 10mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007549Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016733Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023568Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023702Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024180Seawater microbial communities from Monterey Bay, California, United States - 82DEnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025770Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027081Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C33A6_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027198Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027253Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300028129Seawater microbial communities from Monterey Bay, California, United States - 42DEnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031599Marine microbial communities from water near the shore, Antarctic Ocean - #71EnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_10001252223300000101MarineVNDISDKIKAGVPYIDAVIDYAERNGLEIEVVGEIIRKSPMLKAKIYREAEELNMVERVARLPV*
SI34jun09_10mDRAFT_100369493300000224MarineMKEISENINRGVPYIDAVIVYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV*
OpTDRAFT_1002496033300000928Freshwater And MarineMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
JGI26079J46598_100858963300003216MarineMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV*
JGI26086J50260_100822753300003410MarineMKELNSEFIMNEIQSLIGGGVTYIDAIVEFAERNQIEIEVVGEIIRRSPILKAKVHVEAEELNMVDKVTRLPV*
JGI26273J51734_1019376423300003620MarineMKEISENIARGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0078893_1042829453300005837Marine Surface WaterMKEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0078893_1171180013300005837Marine Surface WaterMADKNVELKALSKLNSERIVNDISKHIEAGVTYIDAIVEYAQNNELEIEVLGEIIRKSPMLKANIYREAEKLNMIEKLVRLPV*
Ga0075441_1001190233300006164MarineMKISEQKQEIEILNKLNSQRIMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVERLVRLPV*
Ga0075447_1005723743300006191MarineMKISEQKQEIEILNKLNSQRIMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVRLPV*
Ga0075448_1020371413300006352MarineSQRIMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVERLVRLPV*
Ga0075494_118981623300006382AqueousMVDIAEMITKGVPYIDAVIDYAERHKLEVEVVGEIIRRSPVLRAKIYMEAEELNLVEKLVRLPGMVV*
Ga0098055_1002309133300006793MarineMKEIAENISKGVPYIDAVIVYAEKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0070749_1043996213300006802AqueousMKEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNM
Ga0098045_103026953300006922MarineMKEIAENISKGVPYIDAVIVYAEKYGLEVEVIGEIIRRSPVLKAKIYREAEELN
Ga0098051_106358543300006924MarineMKEIAENISKGVPYIDAVIYYAEKYGLEVEVIGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV*QKACIAHKTHLTFTYAI*
Ga0075468_1002512923300007229AqueousMKEISENIAKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0099851_124894223300007538AqueousMKISDKQDLEILNKLNSEHIINDIAEVISKGVPYIDAVIDYADRHNLEVEVIGEIIKRSPVLKAKIYREAEELNMVEKLVRLPV*
Ga0099847_121560213300007540AqueousGNTIIEKQDLEILNKLSSECIMVDIAEMITKGVPYIDAVIDYAERHKLEVEVVGEIIRRSPVLRAKIYMEAEELNLVEKLVRLPGMVV*
Ga0102879_114586923300007549EstuarineMKEISANIAKGVPYIDAVIVYAESYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0102870_109836913300007625EstuarineIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV*
Ga0102869_109249213300007627EstuarineMKELNSERIMREIQEYIKAGIPYIDAVIEYAEKNEVEIEVVGEIIRRSPVLKAKIHDEAEEL
Ga0102963_136872213300009001Pond WaterMKELNSEKIMNDIREYIEDGVPYIDAIIDYSEREGVEIEVLGEIIRRSPVLKSRIYEEAEKLNMVEASARLPV*
Ga0102812_1015247113300009086EstuarineMKELNSERIMREIQGYIKSGVPYIDAVIEYAEKNEVEIEVVGEIIRRSPVLKAKIHDEAEEL
Ga0114995_1001905663300009172MarineMREINSNILRGVPYIDAVIAYAESYGLEVESVGEIIRKSPVLKAKIYREAEDLNMVEKLTRLPV*
Ga0114995_1010649213300009172MarineMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVRLPV*
Ga0114982_103612543300009419Deep SubsurfaceVPYIDAVLDYAERNELEVEIVGEIIRRSPVLKAKIYREAEELNMVEKLVRLPV*
Ga0114994_1045458913300009420MarineISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVRLPV*
Ga0114994_1056889623300009420MarineMKEISANIARGVPYIDAVIVYAESYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0114994_1074415323300009420MarineREINSNILRGVPYIDAVIAYAESYGLEVESVGEIIRKSPVLKAKIYREAEDLNMVEKLTRLPV*
Ga0115008_1014119033300009436MarineVNDISDKIKAGVPYIDAVIDYAERNGLEIEVVGDIIRKSPMLKAKIYREAEELNMVERVARLPV*
Ga0115101_146278723300009592MarineKRSAYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0115103_106611233300009599MarineMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0115104_1033784513300009677MarineETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV*
Ga0136655_1000382233300010316Freshwater To Marine Saline GradientLIIGNTIIEKQDLEILNKLSSECIMVDIAEMITKGVPYIDAVIDYAERHKLEVEVVGEIIRRSPVLRAKIYMEAEELNLVEKLVRLPGMVV*
Ga0136655_1002297113300010316Freshwater To Marine Saline GradientMKITDKQDIEILNKLNSEHIINDIAEVISKGVSYIDAVIDYAERHNLEVEVIGEIIKRSPVLKAKIYREAEELNMVERLVRLPV*
Ga0129324_1000444213300010368Freshwater To Marine Saline GradientMKITDKQDIEILNKLNSEHIINDIAEVISKGVSYIDAVIDYAERHNLEVEVIGEIIKRSPVLKAKIYREAEELNMVEKLVRLPV*
Ga0129326_122045323300012522AqueousDLEILNKLNSEHIINDIAEVISKGVPYIDAVIDYADRHNLEVEVIGEIIKRSPVLKAKIYREAEELNMVEKLVRLPV*
Ga0182042_139659913300016733Salt MarshAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0182092_113400713300016734Salt MarshKIADNKSIGLIKELNSETIMKEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0182049_126695213300016736Salt MarshIGLIKELNSETIMKEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0182076_127430513300016739Salt MarshVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0182096_137332913300016740Salt MarshEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0182046_149719623300016776Salt MarshKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0180120_1023332423300017697Freshwater To Marine Saline GradientLKVEALGRLNTERIVNDISDKIKAGVPYIDAVIDYAERNGLEIEVVGEIIRKSPMLKAKIYREAEELNMVERVSRLPV
Ga0181391_103374913300017713SeawaterMADKKEEIKAFNRLNSERIMIDIAKHIEAGVPYIDAVVEYAATNELEIEVIGEIIRKSPVLKANIYREAEELNMIEKLV
Ga0181390_101888663300017719SeawaterMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVDKLTRLPV
Ga0181422_113927233300017762SeawaterMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPVXRKACIALKTHLTFTYAI
Ga0181380_123440213300017782SeawaterMDKSTVESGIKALSRINSERIINEIEAHIKAGVPYIDAVVDYATRNELEIEVVGEVIRKSPLLKAKIYREEEDLNMVEKLV
Ga0181600_1028324523300018036Salt MarshMKEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0181560_1014114453300018413Salt MarshMKEIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLT
Ga0182044_100812213300020014Salt MarshIAENISKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLP
Ga0206125_1000822063300020165SeawaterMKEISANIAKGVPYIDAVIVYAESYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0211504_102468943300020347MarineMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0211576_1031647523300020438MarineIGLIKELNSETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0206677_10005461143300021085SeawaterMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0206677_1011578253300021085SeawaterMKEISENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPVXRKACIALK
Ga0206682_1007138453300021185SeawaterMKEISENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0206123_1010101513300021365SeawaterQLNSETIMKEISANIAKGVPYIDAVIVYAESYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0213861_1012131723300021378SeawaterMKEISENIAKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0222715_1040653613300021960Estuarine WaterIADNKNIGLIKELNSETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0222719_1012103943300021964Estuarine WaterMNELNSEFIMNEIQTLIEGGASYIDAIVEFAERNEIEIEVVGEIIRRSPILKARVHVEAEELNMVDRVARLPV
Ga0212023_100036443300022061AqueousMVDIAEMITKGVPYIDAVIDYAERHKLEVEVVGEIIRRSPVLRAKIYMEAEELNLVEKLVRLPGMVV
Ga0196901_103192033300022200AqueousMKISDKQDLEILNKLNSEHIINDIAEVISKGVPYIDAVIDYADRHNLEVEVIGEIIKRSPVLKAKIYREAEELNMVEKLVRLPV
(restricted) Ga0233432_1000671943300023109SeawaterMKEISENIARGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
(restricted) Ga0233432_1008213423300023109SeawaterMKEISENINRGVPYIDAVIVYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0228696_103534723300023568SeawaterSETIMKEIPENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0228682_105829023300023698SeawaterPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0232119_106559523300023702SeawaterLIKELNSETIMKEISENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0228668_110141733300024180SeawaterMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEK
Ga0228666_105422813300024221SeawaterNSETIMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0233399_113124123300024231SeawaterIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLP
(restricted) Ga0233444_1002824313300024264SeawaterIGLIKELNSETIMKEISENIARGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0228610_105085623300024281SeawaterMKEIAENISKGVPYIDSVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0228670_107441423300024319SeawaterKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0228652_104830933300024326SeawaterMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0228631_111796133300024329SeawaterMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNM
Ga0208667_104786223300025070MarineMKEIAENISKGVPYIDAVIVYAEKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0208814_100053943300025276Deep OceanMKISEQKQEIEILNKLNSQRIMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVERLVRLPV
Ga0208303_103075513300025543AqueousISDKQDLEILNKLNSEHIINDIAEVISKGVPYIDAVIDYADRHNLEVEVIGEIIKRSPVLKAKIYREAEELNMVEKLVRLPV
Ga0209654_111302813300025608MarineSETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0209362_125809213300025770MarineDTKSIGLIKELNSETIMKEISENINRGVPYIDAVIVYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0209603_100672163300025849Pelagic MarineLKVEALGRLNTERIVNDISDKIKAGVPYIDAVIDYAERNGLEIEVVGDIIRKSPMLKAKIYREAEELNMVERVARLPV
Ga0209666_106883953300025870MarineMKEISENIARGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPVXQKACIALKTHLTFTYAI
Ga0247581_106997923300026420SeawaterSKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0247577_104025213300026437SeawaterKELNSETIMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0247559_111163413300026443SeawaterIMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0247607_106762423300026447SeawaterSKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0247594_104670913300026448SeawaterMKEIXENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPVXRKACIALKTHLTFTYAI
Ga0247568_101650913300026462SeawaterKELNSETIMKEIAENISKGVPYIDAVIVYADKYGLEVELVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0247599_108585323300026470SeawaterEISENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0247602_105977913300026471SeawaterETIMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0247592_107308813300026500SeawaterMKEISENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPVXRKACIALKTHLTFTYAI
Ga0247605_109177613300026503SeawaterMKEISENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSLVLKAKIYREAEELNMVEKLTRLPVXRKACIALKTHLTFTYAI
Ga0247590_104903513300026513SeawaterADNKNIGLIKELNSETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0208954_103431933300027081MarineMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPVXQKACIAHKTHLTFI
Ga0208163_102144133300027198EstuarineAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0208176_101081013300027248EstuarineVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0208680_104897713300027253EstuarineIMKEISANIAKGVPYIDAVIVYAESYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0209710_1001011273300027687MarineMREINSNILRGVPYIDAVIAYAESYGLEVESVGEIIRKSPVLKAKIYREAEDLNMVEKLTRLPV
Ga0209599_1002688343300027710Deep SubsurfaceVPYIDAVLDYAERNELEVEIVGEIIRRSPVLKAKIYREAEELNMVEKLVRLPV
Ga0209711_1003752553300027788MarineLKVEALGRLNTERIVNDISDKIKAGVPYIDAVIDYAERNGLEIEVVGEIIRKSPMLKAKIYREAEELNMVERVARLPV
Ga0209711_1036512623300027788MarineMKISEQKQEIEILNKLNSQRIMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVR
Ga0209302_1016508523300027810MarineMKISEQKQEIEILNKLNSQRIMTEISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVRLPV
Ga0228674_105113253300028008SeawaterMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLT
Ga0233450_1025827533300028115Salt MarshMDKKELKALQKLNSERIMSEIAGYIAEGVPYIDAVVEYATKNELEIEVIGEIIRKSPVLKANIYREAEELNMIEKL
Ga0228634_106092623300028129SeawaterLIKELNSETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0228619_109234013300028130SeawaterLNSETIMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0256413_103019033300028282SeawaterSENIAKGVPYIDAVIVYADKYGLEVEVIGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0256413_120393613300028282SeawaterIGLIKELNSETIMKEIAENISKGVPYIDAVIVYADKYGLEVEVVGEIIRRSPVLKAKIYREAEELNMVEKLTRLPV
Ga0307488_1007673633300031519Sackhole BrineMKEISENINKGVPYIDAVIVYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPV
Ga0307488_1018919433300031519Sackhole BrineLKVEALGRLNTERIVNDISDKIKAGVPYIDAVIDYAERNGLEIEVVGEIIRKSPMLKAKIYREAEELNMVERV
Ga0308007_1008642813300031599MarineGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVRLPV
Ga0308013_1012667033300031721MarineISKHIAAGVPYIDAVIDYADRNQLEVEVIGEIIRRSPVLKAEIYKEAEELNMVEKLVRLP
Ga0315320_1044678543300031851SeawaterMKEIAENISKGVPYIDAVIYYAEKYGLEVEVVGEIIRRSPVLKAKIYKEAEELNMVEKLTRLPVXQKACIAHKTHLTFTYAILL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.