NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080515

Metagenome / Metatranscriptome Family F080515

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080515
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 72 residues
Representative Sequence MLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTIKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Number of Associated Samples 106
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 69.57 %
% of genes near scaffold ends (potentially truncated) 39.13 %
% of genes from short scaffolds (< 2000 bps) 80.87 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.391 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(13.043 % of family members)
Environment Ontology (ENVO) Unclassified
(33.043 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(46.087 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 13.40%    Coil/Unstructured: 86.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001959|GOS2247_1050994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1036Open in IMG/M
3300003413|JGI25922J50271_10075599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae727Open in IMG/M
3300004112|Ga0065166_10045502All Organisms → Viruses → Predicted Viral1437Open in IMG/M
3300004112|Ga0065166_10176035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae831Open in IMG/M
3300004112|Ga0065166_10302511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii653Open in IMG/M
3300004240|Ga0007787_10715184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae500Open in IMG/M
3300004241|Ga0066604_10352128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae590Open in IMG/M
3300004790|Ga0007758_10620074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae532Open in IMG/M
3300004793|Ga0007760_10642389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae634Open in IMG/M
3300004795|Ga0007756_11536768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae542Open in IMG/M
3300004802|Ga0007801_10047517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1280Open in IMG/M
3300004802|Ga0007801_10074153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae997Open in IMG/M
3300005528|Ga0068872_10276945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae936Open in IMG/M
3300005662|Ga0078894_10029549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae4507Open in IMG/M
3300005941|Ga0070743_10074400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1148Open in IMG/M
3300006037|Ga0075465_10072259All Organisms → cellular organisms → Eukaryota746Open in IMG/M
3300006056|Ga0075163_10784946All Organisms → Viruses → Predicted Viral1002Open in IMG/M
3300006164|Ga0075441_10104711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1084Open in IMG/M
3300006355|Ga0075501_1179824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila538Open in IMG/M
3300006357|Ga0075502_1493348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1011Open in IMG/M
3300006397|Ga0075488_1135228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae588Open in IMG/M
3300006400|Ga0075503_1368851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1672Open in IMG/M
3300006803|Ga0075467_10014986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae5066Open in IMG/M
3300006803|Ga0075467_10017447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea4660Open in IMG/M
3300006803|Ga0075467_10036585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia3110Open in IMG/M
3300006805|Ga0075464_10028426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2960Open in IMG/M
3300006875|Ga0075473_10233610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii743Open in IMG/M
3300007162|Ga0079300_10155578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae618Open in IMG/M
3300007513|Ga0105019_1027260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3779Open in IMG/M
3300007649|Ga0102912_1258252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii500Open in IMG/M
3300007658|Ga0102898_1089590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii708Open in IMG/M
3300007860|Ga0105735_1005172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1921Open in IMG/M
3300008110|Ga0114343_1077806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1199Open in IMG/M
3300008113|Ga0114346_1020653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea3552Open in IMG/M
3300008952|Ga0115651_1028024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea4853Open in IMG/M
3300009003|Ga0102813_1191776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae633Open in IMG/M
3300009055|Ga0102905_1027179All Organisms → Viruses → Predicted Viral1105Open in IMG/M
3300009068|Ga0114973_10564926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae585Open in IMG/M
3300009163|Ga0114970_10052722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2623Open in IMG/M
3300009187|Ga0114972_10029118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3903Open in IMG/M
3300009432|Ga0115005_10234112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1437Open in IMG/M
3300009432|Ga0115005_10325696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1211Open in IMG/M
3300009436|Ga0115008_10375726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1008Open in IMG/M
3300009442|Ga0115563_1168283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea866Open in IMG/M
3300009599|Ga0115103_1710684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea734Open in IMG/M
3300009677|Ga0115104_10675630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii529Open in IMG/M
3300009785|Ga0115001_10248129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1140Open in IMG/M
3300010354|Ga0129333_10171763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1982Open in IMG/M
3300010885|Ga0133913_10505182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida3185Open in IMG/M
3300012418|Ga0138261_1096682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae701Open in IMG/M
3300012504|Ga0129347_1035409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae774Open in IMG/M
3300012523|Ga0129350_1219990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii674Open in IMG/M
3300012706|Ga0157627_1209217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii548Open in IMG/M
3300012723|Ga0157604_1026308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii956Open in IMG/M
3300012724|Ga0157611_1214943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii522Open in IMG/M
3300012965|Ga0129346_1056556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii918Open in IMG/M
3300013004|Ga0164293_10286008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1149Open in IMG/M
3300013005|Ga0164292_10206622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1393Open in IMG/M
3300013006|Ga0164294_10712891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae677Open in IMG/M
3300013087|Ga0163212_1086524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1015Open in IMG/M
(restricted) 3300013131|Ga0172373_10590542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae665Open in IMG/M
3300017107|Ga0186524_105690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1537Open in IMG/M
3300017238|Ga0186197_110643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae944Open in IMG/M
3300018739|Ga0192974_1013032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1351Open in IMG/M
3300019048|Ga0192981_10331415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea559Open in IMG/M
3300020074|Ga0194113_10218762All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1506Open in IMG/M
3300020155|Ga0194050_1105395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae764Open in IMG/M
3300020190|Ga0194118_10058506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2502Open in IMG/M
3300020197|Ga0194128_10558152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300020204|Ga0194116_10246321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae980Open in IMG/M
3300020222|Ga0194125_10769135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae553Open in IMG/M
3300020557|Ga0208231_1003488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea3243Open in IMG/M
3300021342|Ga0206691_1829924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1165Open in IMG/M
3300021345|Ga0206688_10406160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea535Open in IMG/M
3300021365|Ga0206123_10133065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1153Open in IMG/M
3300021376|Ga0194130_10296736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae899Open in IMG/M
3300021962|Ga0222713_10833368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae512Open in IMG/M
3300023500|Ga0257021_1004296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae4607Open in IMG/M
3300024343|Ga0244777_10151269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1498Open in IMG/M
3300025591|Ga0208496_1047935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1022Open in IMG/M
3300025591|Ga0208496_1089235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae673Open in IMG/M
3300025701|Ga0209771_1059669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1373Open in IMG/M
3300025887|Ga0208544_10039180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2368Open in IMG/M
3300025890|Ga0209631_10321332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea742Open in IMG/M
3300025896|Ga0208916_10247612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae774Open in IMG/M
3300026448|Ga0247594_1031875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii890Open in IMG/M
3300026495|Ga0247571_1107681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae649Open in IMG/M
3300027760|Ga0209598_10051764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2112Open in IMG/M
3300027769|Ga0209770_10062348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1569Open in IMG/M
3300027771|Ga0209279_10009034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3570Open in IMG/M
3300027784|Ga0207421_10021744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae5231Open in IMG/M
3300027793|Ga0209972_10445260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae541Open in IMG/M
3300027804|Ga0209358_10411434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae636Open in IMG/M
3300027810|Ga0209302_10109112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1386Open in IMG/M
3300027833|Ga0209092_10453055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae663Open in IMG/M
3300027849|Ga0209712_10329155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii864Open in IMG/M
3300027849|Ga0209712_10715599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae551Open in IMG/M
3300027883|Ga0209713_10979612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae525Open in IMG/M
3300030699|Ga0307398_10034471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2043Open in IMG/M
3300030699|Ga0307398_10051962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1786Open in IMG/M
3300030720|Ga0308139_1070212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae532Open in IMG/M
3300031211|Ga0307974_1181398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae601Open in IMG/M
3300031399|Ga0307968_1129037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae681Open in IMG/M
3300031522|Ga0307388_11144222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii529Open in IMG/M
3300031524|Ga0302320_11880114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae567Open in IMG/M
3300031638|Ga0302125_10080100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1086Open in IMG/M
3300031758|Ga0315907_11106376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii563Open in IMG/M
3300032011|Ga0315316_11138062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae630Open in IMG/M
3300032050|Ga0315906_10211003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1818Open in IMG/M
3300032492|Ga0314679_10003057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3698Open in IMG/M
3300032707|Ga0314687_10001083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3830Open in IMG/M
3300032723|Ga0314703_10005887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae3012Open in IMG/M
3300032727|Ga0314693_10291501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea873Open in IMG/M
3300034021|Ga0335004_0400961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae777Open in IMG/M
3300034068|Ga0334990_0120590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1425Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous13.04%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine12.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.30%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater8.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.22%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater4.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.35%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.35%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.48%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.74%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.74%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.74%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.74%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.74%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.74%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.87%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.87%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.87%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.87%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.87%
Alkaline SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment0.87%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.87%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.87%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.87%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001959Mangrove swamp microbial communities from Isabella Island, Equador - GS032EnvironmentalOpen in IMG/M
3300003413Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DDEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004241Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11EnvironmentalOpen in IMG/M
3300004790Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006037Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNAEnvironmentalOpen in IMG/M
3300006056Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNAEngineeredOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008952Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7umEnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300017107Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/20 medium, no silicate, 19 C, 30 psu salinity and 446 ?mol photons light - Strombidinopsis sp. SopsisLIS2011 (MMETSP0463)Host-AssociatedOpen in IMG/M
3300017238Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)Host-AssociatedOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300023500Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual AssemblyEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025591Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027784Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031211Saline water microbial communities from Organic Lake, Antarctica - #784EnvironmentalOpen in IMG/M
3300031399Saline water microbial communities from Organic Lake, Antarctica - #650EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034021Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GOS2247_105099433300001959MarineMDLDIIAVDGKEVNFKENPFSTVYFENTNPTSESKRIIRVKNSSPILVPFHWAIYKQKNS
JGI25922J50271_1007559913300003413Freshwater LakeMLDLDIIEVDGRSIDFKKNPFSTLFFENTNPTSTTKRTIKIKNSSPILVPFHWSVYKSKNAEKITL*
Ga0065166_1004550233300004112Freshwater LakeMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKHTDKISLADEQAHYRVD
Ga0065166_1017603523300004112Freshwater LakeMLDLDIVEVDGRPIDFKKNPFETLFFENTNPTSVTKRKIKMKNSSPILIPFHWSVYKTKNAEKISLSEDQAHYRVEPV*
Ga0065166_1030251113300004112Freshwater LakeLDLDIVAVDGKEIDFKANPFETIFFENTNPTAESRRTVRIKNSSPIAVPFHWSIYKEKNSNKITLGDE*
Ga0007787_1071518413300004240Freshwater LakeLDIVEVDGRPIDFKKNPFETLFFENTNPTSTTKRTIKLKNSSPILVPFHWSVYKSKFTNMISLMDDQAHYK
Ga0066604_1035212813300004241FreshwaterMLDLDVVEVDSREVDFKKNPFSTLYFENTNPTSTTKRTIKIKNSSPILVPFHWSIYKNKNSNKITLQDE*
Ga0007758_1062007423300004790Freshwater LakeMLDLDIIAVDGKDVDFKANPFETIFFENTNPTAESRRTVRIKNSSPIAVPFHWSIYKEKNSSKIILGDE*
Ga0007760_1064238913300004793Freshwater LakeEFYKVAGYGAMLDLDIIAVDRKEVNFKANPFETIFFENTNPTAESKRTISIKNGSPIAVPFHWSIYKEKNSNKISLQDE*
Ga0007756_1153676813300004795Freshwater LakeLDIVEVDGRPIDFKKNPFETLFFENTNPTSTTKRTIKLKNSSPILVPFHWSVYKSKFTNMISLMDDQAHYKVEPVQGKI*
Ga0007801_1004751733300004802FreshwaterMLDLDIVAVDGKEIDFKANPFETIFFENTNPTAESRRTVKIRNSSPIAVPFHWSIYKEKNSNKITLGDEQTHYRVLP*
Ga0007801_1007415313300004802FreshwaterMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKHTDKISLADEQAHYRVDPVQGKI*
Ga0068872_1027694523300005528Freshwater LakeMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKNTDKISLADE*
Ga0078894_1002954973300005662Freshwater LakeMLDLDIIAVDNKEVNFKQNPFETIFFENTNPTAESRRTISIKNGSPIAVPFHWSIYKDKNSNKISL*
Ga0070743_1007440013300005941EstuarineMDLEIIAVDGKEVNFKENPFETVYFENTNPTSENKRTIRVKNTSPILVPFHWSVFKQKNQQKITLENEEIHYRVEPSHGKIAGGECIDFEMFFCPDH
Ga0075465_1007225913300006037AqueousVKGYGAMLDLDIVEVDGRAVDFRENPFETMFFENTNPTSVTTRRIKVKNLSPLTVSFHWS
Ga0075163_1078494613300006056Wastewater EffluentVIKTSEFYKITGYGAKLDLDIIAVDGREVDFKKNPFSTMFFDNTNPTSSTKRTITIKNNSPILVPFHWSIYKTKNTNKIILSDE*
Ga0075441_1010471123300006164MarineMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTIKLKNTSPIPVPFHWSIYREKNSNKITLGDE*
Ga0075501_117982413300006355AqueousMLDLDIVAVDGKPVDFKVNPFETIFFDNTNPTAESKRRISLKNSSPIGVMFHWSIYKEKNSNKITLGDEP
Ga0075502_149334823300006357AqueousVQGYGAMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE*
Ga0075488_113522823300006397AqueousGFGAMMDLDIIAVDGKEVNFKENPFETVYFENTNPTSESKRTIRVKNTSPILVPFHWSIYK*
Ga0075503_136885133300006400AqueousMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE*
Ga0075467_1001498693300006803AqueousMLDLEITHVDGKEVDFKANPFESIFFDNTNPTASSTRTITVRNTSPITVPFHWSIYKDKNTNKISL*
Ga0075467_1001744733300006803AqueousMLDLDIISVDNKEVDFKTNPFETMYFENTNPTSESRRTIKIKNSAPIPVPYHWSIYKQKNSETISLADE*
Ga0075467_1003658543300006803AqueousMMDLDIVAVDGKEVNFKENPFETVYFDNTNPTSETKRVVRVKNNSPILVPFHWSVYKQKNAAKISLENEETHYKISPSEGKIAGG*
Ga0075464_1002842673300006805AqueousMLDLDIVEVDGRAVDFRENPFETMFFENTNPTSVTTRRIKVKNLSPLTVSFHWSIYKNKNATKISLSDENTHFKIEPSQGKITGGQIIEFEV*
Ga0075473_1023361023300006875AqueousMLDLDIVAVDGKPVDFKVNPFETIFFDNTNPTAESKRRISLKNSSPIGVMFHWSIYKEKNSNKITLGDEPCHYRVVPQQGKIKGNETIEFEIFFSP
Ga0079300_1015557823300007162Deep SubsurfaceAKLDLDIVEVDGRPIDFKKNPFETLFFENTNPTSTTKRTIKLKNSSPILVPFHWSVYKSKFTNMISLMDDQAHYKVEPVQGKI*
Ga0105019_102726013300007513MarineFYKLTGYGAMMDLDIIAVDGKEVNFKENPFETVYFDNTNPTSESKRVIRVKNNSAILVPFHWSIFKSKNA*
Ga0102912_125825213300007649EstuarineMLDLDIVAVDGKDVDFKANPFETIFFENTNPTAESRRTIKLKNSSPIAVPFHWSIYREKNSNKITLGDEQTHYRVVP*
Ga0102898_108959023300007658EstuarineMMDLEIVSVDNKEVDFKANPFETMYFENTNPTSESMRRIKIKNSSPIAVPYHWSIYKQKNSETISLAD
Ga0105735_100517213300007860Estuary WaterMILACDNQTSEFYKVTGYGAVLDLDIIAVDGKEIDFKANPFETIFFDNTNPTAESRRTVKVRNSSPIAVPFHWSIYKEKNSSKITLGDE*
Ga0114343_107780613300008110Freshwater, PlanktonMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYTSKTTDKIRLADE*
Ga0114346_102065343300008113Freshwater, PlanktonMLDLDIIAVDNKEVNFKQNPFETIFFENTNPTAESRRTISIKNESPIAVPFHWSIYKDKNSNKISL*
Ga0115651_102802423300008952MarineLACDNQTSEFYKLTGYGAMMDLDIIAVDGKEVNFKENPFETVYFDNTNPTSESKRVIRVKNNSPILVPFHWSIFKSKNA*
Ga0102813_119177613300009003EstuarineMMDLDIIAVDGKEVNFKENPFDTVYFENTNPTSENKRVVRVRNTSPILVPFHWSVYKLKN
Ga0102905_102717943300009055EstuarineMLDLDIISVDNKEVDFKANPFETMYFENTNPTSESMRTIKIKNSSPISVPYHWSIYKQKNSETISLADEETHYRIEPDQGKITGG*
Ga0114973_1056492623300009068Freshwater LakeMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKNTVKISLADE*
Ga0114970_1005272223300009163Freshwater LakeMLDLDIVEVDGRDIDFKKNPFETLFFENTNPTSMTKRTVKIKNSSPILIPFHWSVYKSKTTNKITLQDE*
Ga0114972_1002911883300009187Freshwater LakeDNQTSEFYKVAGYGAMLDLDIIAVDRKEVNFKANPFETIFFENTNPTAESKRTISIKNGSPIAVPFHWSIYKEKNSNKISLQDE*
Ga0115005_1023411213300009432MarineMMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYKQKNSQKISLENEDTHYRVEPAQGKIPGGQ
Ga0115005_1032569623300009432MarineMMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYKQKNSQKISLENEDTHYRVEPAQGKIPGG
Ga0115008_1037572643300009436MarineDLDIIAVDGKEVNFKENPFETVYFENTNPTSESRRVIRVRNSSPITVPFHWSVYK*
Ga0115563_116828323300009442Pelagic MarineMMDLDIIAVDGKEVNFKENPFETVYFENTNPTSENKRVIRVKNTSPILVPFHWSVYKQKN
Ga0115103_171068433300009599MarineMLDLDIIEVDGKPVNLKENAMDTMFFENTNPTSEATRSIKIKNSSPIRVH
Ga0115104_1067563013300009677MarineMMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYKQKNSQKISLENEDTHYRVEPAQGKIPGGQCIDFEIYFC
Ga0115001_1024812923300009785MarineMMDLDIVAVDGKEVNFKENPFETVYFDNTNPTSECKRVIRVKNNSPILIPFHWSIFKSKDTDKVSLEDQDTHYRIEPA*
Ga0129333_1017176343300010354Freshwater To Marine Saline GradientMIDLDIVKVDGKEVNFKENPFETINFENTNPTSESKRIITVKNSSPILIPFHWSIYKQKNSQKISLD*
Ga0133913_1050518233300010885Freshwater LakeMLDLDIVNVDGKDVDFKANPFETIFFENTNPTAESRRTIRLKNSSPIAVPFHWSIYREKNSNKITLGDE*
Ga0138261_109668223300012418Polar MarineMMDLDIIAVDGKEVNFKENPFETIYFENTNPTSENKRTIRVRNSSPILVPFHWSVYK*
Ga0129347_103540913300012504AqueousVNGNGAMLDLDIESVDGKVVDFKANPLETMYFENTNPTSESRRTIKIKNSSPIPVHYHWSVYR*
Ga0129350_121999013300012523AqueousMLDLDIIAVDGKEVDFKANPFETIFFDNTNPTAESRRTLLIKNSSPIPVPFHWSIYREKNSNKITLGDEQTHYRVHPQ
Ga0157627_120921713300012706FreshwaterMLDLDIVAVDGKDVHFKANPFETIFFENTNPTAESRRTIKLKNSSPIAVPFHWSIYREKNSNKITLGDEQTHYRVVP*
Ga0157604_102630813300012723FreshwaterMLDLDIVAVDGKAVDFKANPFETIFFENTNPTAESRRTIKLKNSSPIAVPFHWSIYREKNSNKITLGDEQTHYRVVP*
Ga0157611_121494313300012724FreshwaterVAVDGKDVDFKANPFETIFFENTNPTAESRRTIKLKNSSPIAVPFHWSIYREKNSNKITLGDEQTHYRVVP*
Ga0129346_105655613300012965AqueousMLDLDIESVDGKVVDFKANPLETMYFENTNPTSESRRTIKIKNSSPIPVHYHWSVYR*
Ga0164293_1028600813300013004FreshwaterLTGYGAKLDLDIVEVDGRPIDFKKNPFETLFFENTNPTSVTKRKMKIKNSSPILVPFHWSVYKTKNAEKISLSDD*
Ga0164292_1020662213300013005FreshwaterLTGYGAKLDLDIVEVDGRPIDFKKNPFETLFFENTNPTSVTKRKMKIKNSSPILVPFHWSVYKTKNAEKISLSD
Ga0164294_1071289113300013006FreshwaterMIDLEIIAVDGKSVNFKENPFETIYFENTNPTSESRRTITVRNSSPIVIPFHWSIYKQKNAQ*
Ga0163212_108652433300013087FreshwaterVLDLDIIAVDGKEINFKTNPFETIFFENTNPTAESRRTVTIKNQAPIAVPFHWSIYKEKNSSKIILGDEQTHYRVVP*
(restricted) Ga0172373_1059054233300013131FreshwaterEVDGRPIDFKKNPFETLFFENTNPTSTTKRKIKVKNSSPILVPFHWSVYKSKTTNKISLTDDQTHYKVEPVQGKI*
Ga0186524_10569023300017107Host-AssociatedLTGFGAKLDLDIVAVDGKPVDFKKNPFETIYFENTNPTSESMRTVTLKNSSAIQVAFHWSIFRNRNTNTITLTDEQTHYRVTPNNGKIAAGET
Ga0186197_11064313300017238Host-AssociatedQTSEFYKLTGYGAMLDLDIVAVDGREVDFKSNPFSTLHFENTNPTSESKRTITIKNSSPILVPFHWSFYKSKNPSVISLDD
Ga0192974_101303233300018739MarineMLDLDIVAVDSKEVDFKANPFETMYFENTNPTSEACRTLKIKNSSPIAVPYHWSVYR
Ga0192981_1033141523300019048MarineMLDLDIIEVDGKPVNLKENAMDTMFFENTNPTSEATRNIKIKNSSPIRVHYHWSI
Ga0194113_1021876233300020074Freshwater LakeVLDLDIIAVDGKEINFKTNPFETIFFENTNPTAESRRTVTIKNQAPIAVPFHWSIYKEKNSSKIILGDEQTHYRVVP
Ga0194050_110539513300020155Anoxic Zone FreshwaterMILACDNQTSEFYKVTGYGAVLDLDIIAVDGKEIDFKANPFETIFFDNTNPTAESRRTVKVRNSSPIAVPFHWSIYKEKNSSKITLGDE
Ga0194118_1005850623300020190Freshwater LakeMLDLDIIKVDGKEVNFKANPFETIFFENTNPTAESKRTISIKNGSPIAVPFHWSIYKEKNSNKISL
Ga0194128_1055815223300020197Freshwater LakeVLDLDIIAVDGKEINFKTNPFETIFFENTNPTAESRRTVTIKNQAPIAVPFHWSIYKEK
Ga0194116_1024632123300020204Freshwater LakeMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKNTDKISLADEQAHYRVDPVQGKI
Ga0194125_1076913523300020222Freshwater LakeLDLDIIAVDGKEINFKTNPFETIFFENTNPTAESRRTVTIKNQAPIAVPFHWSIYKEKNSSKIILGDEQTHYRVVP
Ga0208231_100348833300020557FreshwaterMLDLDIIAVDNKEVNFKQNPFETIFFENTNPTAESRRTISIKNGSPIAVPFHWSIYKDKNSNKISL
Ga0206691_182992423300021342SeawaterLTGYGAMMDLDIIAVDGKEVNFKENPFETVYFDNTNPTSESKRVIRVKNNSPILVPFHWSIFKSKNA
Ga0206688_1040616013300021345SeawaterMLDLDIIEVDGKPVNLKENAMDTMFFENTNPTSEATRNIKIKNSSPIRVHYHWSIYKTKN
Ga0206123_1013306533300021365SeawaterMLDLDIIEVDGKPVNLKENAMDTMFFENTNPTSEATRNIKIKNSSPIRVHYHWSIYKTK
Ga0194130_1029673613300021376Freshwater LakeMIDLEIIAVDGKQVNFKENPFETIYFENTNPTSESCRTITVRNSSPIVIPFHWSIYKQKN
Ga0222713_1083336823300021962Estuarine WaterMMDLDIIAVDGKEVNFKENPFETVYFDNTNPTSESKRVIRVKNSSPILVPFHWSI
Ga0257021_100429683300023500MarineMLDLDITHVDGKEVDFKKHPFSTFFFDDTNPTSTSKRTLTIKNSSPILVPFHWSVFKSKNISKITLQDEETHYRVEPSQGKISGG
Ga0244777_1015126953300024343EstuarineMLDLDIISVDNKEVDFKANPFETMYFENTNPTSESMRTIKIKNSSPISVPYHWSIYKQKNSETISLADEETHYRIEPDQGKITGG
Ga0208496_104793513300025591FreshwaterMLDLDIVAVDGKEIDFKANPFETIFFENTNPTAESRRTVKIRNSSPIAVPFHWSIYKEKNSNKITLGDEQTHYRVLP
Ga0208496_108923523300025591FreshwaterMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKHTDKISLADEQAHYRVDPVQGKI
Ga0209771_105966933300025701MarineMDLEIIAVDGKEVNFKENPFETVYFENTNPTSENKRTIRVKNTSPILVPFHWSVFKQKNQQKITLENEEIH
Ga0208544_1003918043300025887AqueousMLDLDIISVDNKEVDFKTNPFETMYFENTNPTSESRRTIKIKNSAPIPVPYHWSIYKQKNSETISLADE
Ga0209631_1032133223300025890Pelagic MarineMMDLDIIAVDGKEVNFKENPFETVYFENTNPTSENKRVIRVKNTSPILVPFHWSVYKQKNQQKISLENEDTHYRVEPASGKIPGGEYIDFELFFCP
Ga0208916_1024761213300025896AqueousMLDLDIVEVDGRAVDFRENPFETMFFENTNPTSVTTRRIKVKNLSPLTVSFHWSIYKNKNATKISLSDENTHFKIEPSQGKITGGQIIEFEV
Ga0247594_103187523300026448SeawaterMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYK
Ga0247571_110768113300026495SeawaterMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYKQKNSQKISLENEDTHYRVEPAQGKIPGGQCIDFEIYFCPQHAEPYYE
Ga0209598_1005176423300027760Freshwater LakeMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKNTVKISLADE
Ga0209770_1006234823300027769Freshwater LakeMLDLDIIEVDGRSIDFKKNPFSTLFFENTNPTSTTKRTIKIKNSSPILVPFHWSVYKSKNAEKITL
Ga0209279_1000903433300027771MarineMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTIKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Ga0207421_1002174433300027784Alkaline SedimentMLDLDIVAVDGRNVDFKQNPFESLFFENTNPTSTTKRTISIKNTSPILVPFHWSVYKSKNTNKITLGDEQTHYRIEPN
Ga0209972_1044526013300027793Freshwater LakeMLDLDIVEVDGRAIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKNTDKISLADE
Ga0209358_1041143413300027804Freshwater LakeTSEFYKVAGYGAMLDLDIIAVDRKEVNFKANPFETIFFENTNPTAESKRTISIKNGSPIAVPFHWSIYKEKNSNKISLQDE
Ga0209302_1010911213300027810MarineMLDLDIIEVDGKTVDLKENAMDTMFFENTNPTSEATRTIKIKNSAPIRVAYHWSIYKTKNTNKIILE
Ga0209092_1045305523300027833MarineYGAMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Ga0209712_1032915513300027849MarineMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHW
Ga0209712_1071559913300027849MarineMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYKQKNSQKISLENEDTH
Ga0209713_1097961213300027883MarineMMDLDIVAVDGKEVNFKENPFETVYFENTNPTSESKRTVRVKNTSPILVPFHWSIYKQKNSQKITLENEDTHYRVEPAQGKIPGGQY
Ga0307398_1003447143300030699MarineMLDLDIIAVDGKDVDFKANPFETIFFDNTNPTAESRRTLRLKNSSPIAVPFHWSIYREKNSNKITLGDEQTHYRVSPQ
Ga0307398_1005196243300030699MarineMLDLDIVEIDGKAVDLNQNALETMFFENTNPTSETRRTIKLKNGSPIAVPYHWSVYKTK
Ga0308139_107021223300030720MarineGYGAMMDLDIIAVDNKEVNFKENPFETVYFENTNPTSENMRTIRVRNSSPILVPFHWSVY
Ga0307974_118139813300031211Saline WaterMLDIDVVGVDGREVDFKMNPFSTINFENTNPTSESRRTIKIKNESPILVPFHWSVFKNKNLNKISLQDE
Ga0307968_112903713300031399Saline WaterLTGKGTMLDIDVVGVDGREVDFKMNPFSTINFENTNPTSESRRTIKIKNESPILVPFHWSVFKNKNLNKISLQDE
Ga0307388_1114422213300031522MarineMLDLDIVSVDNKEVDFKANPFETMYFENTNPTSESTRTIKIKNSSAIPVPYHWSIYK
Ga0302320_1188011413300031524BogMLDLDIIEVDGRSIDFKKNPFETLFFENTNPTSTTKRKIKIKNSSPILVPFHWSVYKSKTTNMISLQDEQ
Ga0302125_1008010023300031638MarineMLDLDIVAVDSKEVDFKANPFETMYFENTNPTSEAIRTLKIKNSSPIAVPYHWSVYR
Ga0315907_1110637613300031758FreshwaterMLDLDIVAVDGKDVDFKANPFETIFFENTNPTAESRRTIKLKNSSPIAVPFHWSIYREKNSNKITLGDEQTHYRVVP
Ga0315316_1113806213300032011SeawaterKLTGYGAMMDLDIIAVDGKEVNFKENPFETVYFENTNPTSENRRVIRVKNTSPILVPFHWSVYK
Ga0315906_1021100313300032050FreshwaterIVAVDDKEVDFKKNPFETMYFENTNPTSESCRKIKIKNSAPIHFPFHWSVYKQKNS
Ga0314679_1000305753300032492SeawaterMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Ga0314687_1000108313300032707SeawaterGYGAMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Ga0314703_1000588753300032723SeawaterTSEFYKVQGYGAMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Ga0314693_1029150123300032727SeawaterVQGYGAMLDLDIVAVDGKEVDFKANPFETIFFDNTNPTAESRRTLKLKNTSPIPVPFHWSIYREKNSNKITLGDE
Ga0335004_0400961_221_4093300034021FreshwaterMIDLEIIAVDGKSVNFKENPFETIYFENTNPTSESRRTITVRNSSPIVIPFHWSIYKQKNAQ
Ga0334990_0120590_537_7103300034068FreshwaterMMDLDVIAVDGKEVNFKVNPFQTIYFENTNPTSENKKVIRVKNSSPLMVPFHWSIYK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.