NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080513

Metagenome / Metatranscriptome Family F080513

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080513
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 123 residues
Representative Sequence MTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWAEE
Number of Associated Samples 98
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 39.13 %
% of genes near scaffold ends (potentially truncated) 40.87 %
% of genes from short scaffolds (< 2000 bps) 74.78 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(15.652 % of family members)
Environment Ontology (ENVO) Unclassified
(66.957 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.087 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 73.77%    β-sheet: 0.00%    Coil/Unstructured: 26.23%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF02399Herpes_ori_bp 13.04
PF00145DNA_methylase 4.35
PF00171Aldedh 1.74
PF00589Phage_integrase 1.74
PF13240zinc_ribbon_2 0.87
PF10544T5orf172 0.87
PF04138GtrA 0.87
PF13936HTH_38 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 4.35
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.74
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.74
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2043231002|Landsort10m_GCH9ZVC01BQMM8All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48505Open in IMG/M
3300000930|BpDRAFT_10222655All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482940Open in IMG/M
3300003580|JGI26260J51721_1025121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481146Open in IMG/M
3300004097|Ga0055584_100023986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin485987Open in IMG/M
3300005837|Ga0078893_12120202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin489832Open in IMG/M
3300005912|Ga0075109_1019678All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482802Open in IMG/M
3300005912|Ga0075109_1270283All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48508Open in IMG/M
3300005933|Ga0075118_10226268All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48596Open in IMG/M
3300005941|Ga0070743_10002017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales7670Open in IMG/M
3300005942|Ga0070742_10087796All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48855Open in IMG/M
3300005951|Ga0066379_10001076All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin486237Open in IMG/M
3300005951|Ga0066379_10124589All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48814Open in IMG/M
3300006029|Ga0075466_1073825All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48961Open in IMG/M
3300006164|Ga0075441_10118580All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481008Open in IMG/M
3300006164|Ga0075441_10152590All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48870Open in IMG/M
3300006191|Ga0075447_10088260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481086Open in IMG/M
3300006191|Ga0075447_10124757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48877Open in IMG/M
3300006352|Ga0075448_10042252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481463Open in IMG/M
3300006352|Ga0075448_10282129All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48503Open in IMG/M
3300006382|Ga0075494_1391282All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48806Open in IMG/M
3300006399|Ga0075495_1606017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481545Open in IMG/M
3300006947|Ga0075444_10228747All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48739Open in IMG/M
3300007548|Ga0102877_1067322All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481027Open in IMG/M
3300007551|Ga0102881_1126049All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48708Open in IMG/M
3300007620|Ga0102871_1209538All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48542Open in IMG/M
3300007992|Ga0105748_10535942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48513Open in IMG/M
3300008999|Ga0102816_1162700All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48693Open in IMG/M
3300009076|Ga0115550_1111430All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48998Open in IMG/M
3300009076|Ga0115550_1260605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48565Open in IMG/M
3300009077|Ga0115552_1412860All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48532Open in IMG/M
3300009425|Ga0114997_10000875All Organisms → cellular organisms → Bacteria25029Open in IMG/M
3300009426|Ga0115547_1059929All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481319Open in IMG/M
3300009432|Ga0115005_10074503All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482599Open in IMG/M
3300009436|Ga0115008_10021118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin485274Open in IMG/M
3300009438|Ga0115559_1280191All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48587Open in IMG/M
3300009443|Ga0115557_1150026All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48943Open in IMG/M
3300009445|Ga0115553_1045605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482040Open in IMG/M
3300009447|Ga0115560_1127616All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481023Open in IMG/M
3300009495|Ga0115571_1253737All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48706Open in IMG/M
3300009496|Ga0115570_10015985All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin484633Open in IMG/M
3300009496|Ga0115570_10104409All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481379Open in IMG/M
3300009505|Ga0115564_10508866All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48579Open in IMG/M
3300009507|Ga0115572_10047230All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482754Open in IMG/M
3300009512|Ga0115003_10284204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48981Open in IMG/M
3300009512|Ga0115003_10523687All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48693Open in IMG/M
3300009544|Ga0115006_11544603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48601Open in IMG/M
3300010316|Ga0136655_1010543All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin483313Open in IMG/M
3300010368|Ga0129324_10120405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481115Open in IMG/M
3300010368|Ga0129324_10261709All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48687Open in IMG/M
3300010883|Ga0133547_10077920All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin487496Open in IMG/M
3300012516|Ga0129325_1114646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481002Open in IMG/M
3300012522|Ga0129326_1381542All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481039Open in IMG/M
3300012524|Ga0129331_1286417All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481268Open in IMG/M
3300012969|Ga0129332_1467029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48816Open in IMG/M
3300013010|Ga0129327_10125869All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481269Open in IMG/M
3300017697|Ga0180120_10111646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481182Open in IMG/M
3300017752|Ga0181400_1161360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48632Open in IMG/M
3300017824|Ga0181552_10097540All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481635Open in IMG/M
3300018413|Ga0181560_10212852All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48936Open in IMG/M
3300018415|Ga0181559_10234159All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481042Open in IMG/M
3300018417|Ga0181558_10079189All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482104Open in IMG/M
3300018876|Ga0181564_10670606All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48547Open in IMG/M
3300020165|Ga0206125_10007718All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin488291Open in IMG/M
3300020166|Ga0206128_1040794All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482348Open in IMG/M
3300020166|Ga0206128_1146511All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48958Open in IMG/M
3300020182|Ga0206129_10182574All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48949Open in IMG/M
3300020187|Ga0206130_10349343All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48614Open in IMG/M
3300020187|Ga0206130_10417120All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48533Open in IMG/M
3300020396|Ga0211687_10025337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482911Open in IMG/M
3300020601|Ga0181557_1132114All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481063Open in IMG/M
3300021365|Ga0206123_10164693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481007Open in IMG/M
3300021373|Ga0213865_10418267All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48591Open in IMG/M
3300021389|Ga0213868_10589060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48584Open in IMG/M
3300022061|Ga0212023_1021005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48886Open in IMG/M
3300022072|Ga0196889_1020937All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481361Open in IMG/M
(restricted) 3300022920|Ga0233426_10103710All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481254Open in IMG/M
3300022929|Ga0255752_10077344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481908Open in IMG/M
(restricted) 3300022933|Ga0233427_10011495All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin486095Open in IMG/M
3300024343|Ga0244777_10080406All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin482097Open in IMG/M
3300025138|Ga0209634_1135289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481029Open in IMG/M
3300025483|Ga0209557_1004836All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin486068Open in IMG/M
3300025513|Ga0208413_1074312All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48985Open in IMG/M
3300025603|Ga0208414_1171965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48530Open in IMG/M
3300025620|Ga0209405_1000029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae116817Open in IMG/M
3300025704|Ga0209602_1207749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48576Open in IMG/M
3300025767|Ga0209137_1194709All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48689Open in IMG/M
3300025809|Ga0209199_1011466All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin486456Open in IMG/M
3300025874|Ga0209533_1098508All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481454Open in IMG/M
3300025876|Ga0209223_10081803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481828Open in IMG/M
3300025876|Ga0209223_10112569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481465Open in IMG/M
3300025876|Ga0209223_10283902All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48759Open in IMG/M
3300025880|Ga0209534_10349130All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48660Open in IMG/M
3300026086|Ga0207964_1001272All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin485746Open in IMG/M
3300026086|Ga0207964_1025513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481292Open in IMG/M
3300027229|Ga0208442_1054605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48684Open in IMG/M
3300027418|Ga0208022_1131370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48501Open in IMG/M
3300027631|Ga0208133_1071055All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48826Open in IMG/M
3300027668|Ga0209482_1039037All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481833Open in IMG/M
3300027668|Ga0209482_1134562All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48746Open in IMG/M
3300027668|Ga0209482_1156474All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48667Open in IMG/M
3300027686|Ga0209071_1049086All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481286Open in IMG/M
3300027779|Ga0209709_10012673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin485921Open in IMG/M
3300027833|Ga0209092_10024866All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin483939Open in IMG/M
3300027849|Ga0209712_10013938All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin485738Open in IMG/M
3300028198|Ga0257121_1136532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48844Open in IMG/M
3300028284|Ga0257120_1027843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481712Open in IMG/M
3300031519|Ga0307488_10034025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin484045Open in IMG/M
3300031594|Ga0302131_1077622All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481188Open in IMG/M
3300031606|Ga0302119_10017432All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin483054Open in IMG/M
3300031608|Ga0307999_1159798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48520Open in IMG/M
3300031629|Ga0307985_10165914All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48876Open in IMG/M
3300031660|Ga0307994_1098579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481050Open in IMG/M
3300031696|Ga0307995_1078845All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481316Open in IMG/M
3300031696|Ga0307995_1088149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin481226Open in IMG/M
3300031702|Ga0307998_1148228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → SAR92 clade → SAR92 bacterium BACL16 MAG-120619-bin48828Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine13.91%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.43%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.83%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.09%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh6.09%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater6.09%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.22%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine5.22%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.35%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.61%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.61%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake2.61%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.74%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.74%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.74%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.87%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.87%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
204323100210 m water depthEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005912Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKDEnvironmentalOpen in IMG/M
3300005933Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKEEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300005951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009426Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020601Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025513Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD (SPAdes)EnvironmentalOpen in IMG/M
3300025603Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300026086Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028198Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100EnvironmentalOpen in IMG/M
3300028284Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_10EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031606Marine microbial communities from Western Arctic Ocean, Canada - AG5_TmaxEnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031702Marine microbial communities from David Island wharf, Antarctic Ocean - #37EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
10m_2242402043231002MarineLWLYQLTDQDLLQLYALFTPNDIIREFKPRKSEKRKIYLQPNSKYRLDRPIQARKYLERIILAACPEEIGFEDWEKVYEQKIEYVRAEALSRLWKRIGKHESLWAEE
BpDRAFT_1022265523300000930Freshwater And MarineMKSGKASKVEMTPIKYPRDEYSHQAYLQYQLTDQDLLQLYALFTPSEIIREFNSGRVRSEKSIYNLISKYMLDRPLQARKYLERIILAACPEEVGFEDWENLVEEKISYVRAEALAVLWKRINKHESFWVES*
JGI26260J51721_102512123300003580MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMIFVRAEALSRLWKRIGKHEYLWAER*
Ga0055584_10002398663300004097Pelagic MarineMKSGKASKVEMIPIKYPRDEYSHQAYLQYQLTDQDLLQLYALFTPSEIIREFNSGRVRSEKSIYNLISKYRLDRPLQARKYLERLILAACPEEVGFEDWENLVEEKISYVRAEALAVLWKRINKHESFWDES*
Ga0078893_1212020283300005837Marine Surface WaterMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER*
Ga0075109_101967843300005912Saline LakeLKSETYPKDSNSHQSHVQYDLTDIDLLQLYALLTPSEIIKEFGARSRCEKSIYNLIHKYRLDRPLKARQYLERIILAACPEEVGFEDWEILLKNKLSYVRAEALMRMWKRIDKHESFWKIE*
Ga0075109_127028313300005912Saline LakeMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWA
Ga0075118_1022626823300005933Saline LakeLKLETYPKDSNSHQSHVQYELTDQDLLQLYALFTPPEIIREFNRGRVRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKNKLSYVRAEALSRMWKVIDKHESFWKTE*
Ga0070743_1000201723300005941EstuarineMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE*
Ga0070742_1008779623300005942EstuarineLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE*
Ga0066379_1000107633300005951MarineMTYRDNKRPLKPSRKTMQPTHYPKDSSSLQSHVFYELTDQDLLQLYALFTPSEIVREFKSHRVRSAKSIYTLISKYKLDRPVQAKKYLQRLVLAACPDEVGFDDWEKVYKEKIGYVRAEALSRLWQRIDKHESLWEIQ*
Ga0066379_1012458913300005951MarineMNQQNYPKDSNSLQSDMVYQLTDQDLLQLYALFTPAEIIKEFRPWRVRCEKSIYNLIRRCKLDRPLQARKYLERIILAACPEEVGFDDWEKLVADKLGYVRAESLVRMWKKIDNHEALWESK*
Ga0075466_107382523300006029AqueousMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0075441_1011858023300006164MarineLKSEIYPKDSSSRQSHELYELTDIDLLQLYALYTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIMLAACPEEIGFEDWEILLKNKLSYVRAEALMRMWKRIHKHESFWKIE*
Ga0075441_1015259013300006164MarineLKLETYPKDSYSRQSHVQYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEVGFEDWEMLLKNKLSYVRAEALMRMWKRIHKHESFWKIE*
Ga0075447_1008826033300006191MarineMSYQLTDQDLLQLYALFTPAEILKEFNVDRVRCQKSIYNLVNRYGLDKPFLARRYLQRMFTAACPEEVGFSDWDAIYEKKICYVRAEALARLWKRISKHEALWAED*
Ga0075447_1012475723300006191MarineLQPLAKPLGRPLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIMLAACPEEIGFEDWEILLKNKLSYVRAEALMRMWRRIHKHESFWKIE*
Ga0075448_1004225223300006352MarineAKPLGRPLKPEKYPKDSYSHQSCVQYQLTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKNKLSYVRAEALMRMWKRIHKHESFWKIE*
Ga0075448_1028212913300006352MarineFYFPRKALKKKKMSSYPKNQFSHQSYMSYQLTDQDLLQLYALFTPAEILKEFNVDRVRCQKSIYNLVNRYGLDKPFLARRYLQRMFTAACPEEVGFSDWDAIYEKKICYVRAEALARLWKRISKHEALWAED*
Ga0075494_139128213300006382AqueousSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRLVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0075495_160601713300006399AqueousSLSAQSLKKKPMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0075444_1022874723300006947MarineLQPLAKPLGRPLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEILLKTKLSYVRAEALSRMWKRIDKHESFWKIE*
Ga0102877_106732213300007548EstuarineLSAQSLKKKPMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE*
Ga0102881_112604913300007551EstuarineRISLKPSWKTMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE*
Ga0102871_120953813300007620EstuarineMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE*
Ga0105748_1053594223300007992Estuary WaterYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQSKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE*
Ga0102816_116270013300008999EstuarineLKKKPMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQKLVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0115550_111143023300009076Pelagic MarineMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES*
Ga0115550_126060523300009076Pelagic MarineTYYPKDSNSPQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLTACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0115552_141286023300009077Pelagic MarineQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES*
Ga0114997_10000875173300009425MarineLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLNPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLKKIILAACPEEIGFEDWEILLKNKLSYVRAEALMRMWKRIDKHESFWKIE*
Ga0115547_105992923300009426Pelagic MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWAEE*
Ga0115005_1007450313300009432MarineQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEIGFEDWEKVYEQKIEYVRAEALSHLWKRIGKHESLWAEE*
Ga0115008_1002111823300009436MarineMKSSKAVKAKMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPSDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWAEE*
Ga0115559_128019123300009438Pelagic MarineMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRLVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0115557_115002613300009443Pelagic MarineMTHLNYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES*
Ga0115553_104560523300009445Pelagic MarineMTPLDHPKDSHSLQPYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES*
Ga0115560_112761613300009447Pelagic MarineKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER*
Ga0115571_125373713300009495Pelagic MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALLTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER*
Ga0115570_1001598553300009496Pelagic MarineFKKKMTHLNYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFNSGRVRSEKSIYNLISKYRLDRPLQARKYLERLILAACPEEVGFEDWENLVEEKISYVRAEALAVLWKRINKHESFWDES*
Ga0115570_1010440913300009496Pelagic MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPSDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER*
Ga0115564_1050886623300009505Pelagic MarineKPMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRLVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0115572_1004723023300009507Pelagic MarineMTPLNHPKDSRSQQSYALYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER*
Ga0115003_1028420413300009512MarineMSIYVKYTLYINNLAILSRGPAQRFKKKMTPLNYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPARVRSEKSIYNLISRYKLDKPLRARKYLERIILAACPEEIGFKDWEKLVADKMCFVRAEALSRLWERISKHEYLW
Ga0115003_1052368723300009512MarineIKYSPAIKSHAQPLGRSLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEILVKNKLGYVRAEALMRMWKRIDKHESFWKVE*
Ga0115006_1154460313300009544MarineKDFYSPQSNEFYELTDIDLLQLYALLTPSQIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEILLKNKLSYVRAEALMRMWKRIDKHESFWEIE*
Ga0136655_101054323300010316Freshwater To Marine Saline GradientMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKMDKPLQARKYLERIILAACPEEIGFDDWEKLVADKMCFVREEALSRLWTRIGKHECLWAES*
Ga0129324_1012040523300010368Freshwater To Marine Saline GradientMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMCFVRAEALSRLWTRIGKHEYLWAES*
Ga0129324_1026170923300010368Freshwater To Marine Saline GradientMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLIADKMSFVRAEALSRLWKRIGKHEYLWAER*
Ga0133547_1007792033300010883MarineVFSRHLLKYLSLQKMSIYVKYTLYINNLAILSRGPAQRFKKKMTPLNYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPARVRSEKSIYNLISRYKLDKPLRARKYLERIILAACPEEIGFKDWEKLVADKMCFVRAEALSRLWERISKHEYLWAES*
Ga0129325_111464613300012516AqueousMYPTYYPKDSNSLQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYDEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0129326_138154213300012522AqueousATSLSAQSLKKKPMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYDEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0129331_128641713300012524AqueousMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0129332_146702913300012969AqueousPTSRSRAKPPKKTMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE*
Ga0129327_1012586923300013010Freshwater To Marine Saline GradientMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPRRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWAEE*
Ga0180120_1011164613300017697Freshwater To Marine Saline GradientMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPRRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKISFVRAEALSRLWKRIGKHESLWAEE
Ga0181400_116136023300017752SeawaterMPYKTQRNDNRHHSSMVYQLTDQDLLQLYALFTPAEIIKEFKPWRVRCEKSIYNLIRKCKLDRPLQARKFLEKIILAACPEEVGFDDWEKLVKEKLGYVKAEALVRMWKKIDSHESLWG
Ga0181552_1009754013300017824Salt MarshPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREEALSRLWTRIGKHECLWAES
Ga0181560_1021285223300018413Salt MarshMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREEALSRLWTRIGKHECLWAES
Ga0181559_1023415913300018415Salt MarshMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEETGFNDWEKLVADKMNFVREEALSRLWTRIGKHECLWAES
Ga0181558_1007918923300018417Salt MarshMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKLNFVREEALSRLWTRIGKHECLWAES
Ga0181564_1067060613300018876Salt MarshSPAQRFKKKMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREEALSRLWTRIGKHECLWAES
Ga0206125_1000771873300020165SeawaterMKSGKASKVEMIPIKYPRDEYSHQAYLQYQLTDQDLLQLYALFTPSEIIREFNSGRVRSEKSIYNLISKYRLDRPLQARKYLERLILAACPEEVGFEDWENLVEEKISYVRAEALAVLWKRINKHESFWDES
Ga0206128_104079423300020166SeawaterNIHINQSLSSTFMKSGKASKVEMIPIKYPRDEYSHQAYLQYQLTDQDLLQLYALFTPSEIIREFNSGRVRSEKSIYNLISKYRLDRPLQARKYLERLILAACPEEVGFEDWENLVEEKISYVRAEALAVLWKRINKHESFWDES
Ga0206128_114651113300020166SeawaterMTPLDHPKDSHSLQPYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMCFVRAEALSRLWTRIGKHEYLWAES
Ga0206129_1018257413300020182SeawaterRYSLQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRLVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0206130_1034934313300020187SeawaterHDLLQFYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0206130_1041712013300020187SeawaterDYPKDSRSLQSYLLYQLTDQDLLQLYALFAPSEIIREFTPARVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES
Ga0211687_1002533743300020396MarineMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEK
Ga0181557_113211423300020601Salt MarshSPAQRFKKKMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFAPSEIIREFTPARVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKLNFVREEALSRLWTRIGKHECLWAES
Ga0206123_1016469323300021365SeawaterQSLSSTFMKSGKASKVEMIPIKYPRDEYSHQAYLQYQLTDQDLLQLYALFTPSEIIREFNSGRVRSEKSIYNLISKYRLDRPLQARKYLERLILAACPEEVGFEDWENLVEEKISYVRAEALAVLWKRINKHESFWDES
Ga0213865_1041826723300021373SeawaterMPYKTQRNDNRHQSSMVYQLTDQDLLQLYALFTPAEIIKEFKPWRVRCEKSIYNLIRKCKLDRPLQARKFLEKIILAACPEEVGFDDWEKLVKEKLGYVKAEALVRMWKKIDSHESLWG
Ga0213868_1058906023300021389SeawaterPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKLNFVREEALSRLWTRIGKHECLWAES
Ga0212023_102100513300022061AqueousMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0196889_102093723300022072AqueousMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
(restricted) Ga0233426_1010371023300022920SeawaterMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWAEE
Ga0255752_1007734413300022929Salt MarshNNLADLLRGPAQRFKKKMTPLDYPKDSRSLQSYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREEALSRLWTRIGKHECLWAES
(restricted) Ga0233427_1001149573300022933SeawaterKKKKMPSYPKNRFSHQSYVRYVLTDEDLLQLYALFTPSEIIREFLPDRCRSESSIYNLIRGYGLDRPLKAKKYLQRIVVACCPEEVGFDDWEKLVEEKISYVRAEALAVLWKRISKHEHLWAED
Ga0244777_1008040623300024343EstuarineMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE
Ga0209634_113528923300025138MarineMYPETYPRDHNSHQAYLQYVLTDQDLLQLYALFTPSEIVREFKPWRVRSEKSIYNLINRYRLDSPLRAKKYLERLILAACPEEVGFSDWEQLVADKISFVRAETLSRLWKIIRKHESFWDEK
Ga0209557_100483613300025483MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMIFVRAEALSRLWKRIGKHEYLWAER
Ga0208413_107431213300025513Saline LakePRYKSRAKPLGRPLKSETYPKDSNSHQSHVQYDLTDIDLLQLYALLTPSEIIKEFGARSRCEKSIYNLIHKYRLDRPLKARQYLERIILAACPEEVGFEDWEILLKNKLSYVRAEALMRMWKRIDKHESFWKIE
Ga0208414_117196513300025603Saline LakeLKPETYPKDSSSHQSHVQYELTDQDLLQLYALFTPPEIIKEFNCGRVRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKNKLSYVRAEALSRMWKVIDKHESFWKTE
Ga0209405_1000029963300025620Pelagic MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER
Ga0209602_120774913300025704Pelagic MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPSDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER
Ga0209137_119470923300025767MarineSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0209199_101146623300025809Pelagic MarineVLYQLTDQDLLQLYALLTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHEYLWAER
Ga0209533_109850823300025874Pelagic MarineMYPTYYPKDSNSPQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLTACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0209223_1008180323300025876Pelagic MarineMLPETYPKDRYSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRLVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0209223_1011256913300025876Pelagic MarineMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWERIGKHE
Ga0209223_1028390213300025876Pelagic MarineMTPLDHPKDSHSLQPYLLYQLTDQDLLQLYALFTPSEIIREFTPGRVRSEKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES
Ga0209534_1034913013300025880Pelagic MarineMTPLDHPKDSHSLQPYLLYQLTDQDLLQLYALFTPSKIIREFTPGRVRSDKSIYNLISRYKLDKPLQARKYLERIILAACPEEIGFNDWEKLVADKMNFVREKALSPLWERIGKHEYLWAES
Ga0207964_100127243300026086MarineMNQQNYPKDSNSLQSDMVYQLTDQDLLQLYALFTPAEIIKEFRPWRVRCEKSIYNLIRRCKLDRPLQARKYLERIILAACPEEVGFDDWEKLVADKLGYVRAESLVRMWKKIDNHEALWESK
Ga0207964_102551323300026086MarineMTYRDNKRPLKPSRKTMQPTHYPKDSSSLQSHVFYELTDQDLLQLYALFTPSEIVREFKSHRVRSAKSIYTLISKYKLDRPVQAKKYLQRLVLAACPDEVGFDDWEKVYKEKIGYVRAEALSRLWQRIDKHESLWEIQ
Ga0208442_105460523300027229EstuarineRISLKPSWKTMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWDKE
Ga0208022_113137013300027418EstuarineMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWD
Ga0208133_107105523300027631EstuarineMYPTYYPKDSNSPQSHVSYELTDQDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKRYLQRVVLAACPEEIGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0209482_103903733300027668MarineMSSYPKNQFSHQSYMSYQLTDQDLLQLYALFTPAEILKEFNVDRVRCQKSIYNLVNRYGLDKPFLARRYLQRMFTAACPEEVGFSDWDAIYEKKICYVRAEALARLWKRISKHEALWAED
Ga0209482_113456213300027668MarineLQPLAKPLGRPLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIMLAACPEEIGFEDWEILLKNKLSYVRAEALMRMWRRIHKHESFWKIE
Ga0209482_115647413300027668MarineHQSYISYQLTDHDLLQLYALFTPSEIIKEFNVDRVRCEKSIYNLVHKYRLDRPFLARRYLQRMFTAACPEEVGFSDWDAIYEKKIGYVRAEALAKLWKRISKHEAFWAKD
Ga0209071_104908623300027686MarineLKSGTYPKDSSSQQSHVQYELTDQDLLQLYALFTPPEIIREFNRGRVRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKNKLSYVRAEALMRMWKRIHKHESFWKIE
Ga0209709_1001267323300027779MarineLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLNPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLKKIILAACPEEIGFEDWEILLKNKLSYVRAEALMRMWKRIDKHESFWKI
Ga0209092_1002486623300027833MarineMKSSKAVKAKMTPLNHPKDSRSQQSYVLYQLTDQDLLQLYALFTPSDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKMSFVRAEALSRLWKRIGKHESLWAEE
Ga0209712_1001393893300027849MarineMLPETYPKDRNSPQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEIGFEDWEKVYEQKIEYVRAEALSHLWKRIGKHESLWAEE
Ga0257121_113653223300028198MarineMPSYPKNRFSHQSYVRYVLTDEDLLQLYALFTPSEIIREFLPDRCRSESSIYNLIRGYGLDRPLKAKKYLQRIVVACCPEEVGFDDWEKLVEEKISYVRAEALAVLWKRISKHEHLWAED
Ga0257120_102784353300028284MarineMTPLNHPKDSRSQQSYVLYQLADQDLLQLYALFTPNDIIREFKPGRVRSEKSIYNLISKYRLDRPIQARKYLERIILAACPEEIGFTDWEKLVADKISFVRAEALSRLWKRIGKHESLWAEE
Ga0307488_1003402523300031519Sackhole BrineMYPTYYPKDSNSPQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0302131_107762213300031594MarineASLKPSWKTMYPTYYPKDSNSLQSHVSYELTDHDLLQLYALFTPSEILREFKSDRVRSIKSIYNLISRYKLDRPVQAKKYLQRVVLAACPEEVGFEDWEKVYEEKIEYVRAEALSRLWKRIGKHESLWAEE
Ga0302119_1001743223300031606MarineLKSEIYPKDSSSRQSNEFYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKTKLSYVRAEALMRMWKRIHKHESFWKI
Ga0307999_115979813300031608MarineMSYQLTDQDLLQLYALFTPAEILKEFNVDRVRCQKSIYNLVNRYGLDKPFLARRYLQRMFTAACPEEVGFSDWDAIYEKKICYVRAEALARLWKRIS
Ga0307985_1016591423300031629MarineLQPLAKPLGRPLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEILLKTKLSYVRAEALMRMWKRIDKHESFWKIE
Ga0307994_109857923300031660MarineLQPLAKPLGRPLKSEIYPKDSSSRQSHELYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKNKLSYVRAEALMRMWKRIHKYESFWKIE
Ga0307995_107884523300031696MarineMPSYPKNSFSHQSNVQYQLTDHDLLQLYALFTPSEIIKEFNVDRVRCEKSIYNLVHKYRLDRPFLARRYLQRMFTAACPEEVGFSDWDAIYEKKIGYVRAEALAKLWKRISKHEAFWAED
Ga0307995_108814923300031696MarineLKLETYPKDSSSRQSYEFYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEVGFPDWEMLLKNKLSYVRAEALMR
Ga0307998_114822823300031702MarineLKSEKYPKDSSSRQSHEFYELTDIDLLQLYALLTPSEIIKEFGRRSRCEKSIYNLIHKYRLDRPLKARQYLEKIILAACPEEIGFEDWEMLLKTKLSYVRAEALSRMWKRIDKHESFWKI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.