NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080447

Metagenome / Metatranscriptome Family F080447

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080447
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 40 residues
Representative Sequence VLFIIALTYMFSGVFWRLQWIFRRKRNPPPPPYKEASQTS
Number of Associated Samples 107
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 99.13 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(6.957 % of family members)
Environment Ontology (ENVO) Unclassified
(20.870 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.174 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 36.76%    β-sheet: 0.00%    Coil/Unstructured: 63.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF01118Semialdhyde_dh 54.78
PF02774Semialdhyde_dhC 33.04
PF06144DNA_pol3_delta 4.35
PF04390LptE 4.35
PF02367TsaE 0.87
PF01649Ribosomal_S20p 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0002N-acetyl-gamma-glutamylphosphate reductaseAmino acid transport and metabolism [E] 33.04
COG0136Aspartate-semialdehyde dehydrogenaseAmino acid transport and metabolism [E] 33.04
COG1466DNA polymerase III, delta subunitReplication, recombination and repair [L] 4.35
COG2812DNA polymerase III, gamma/tau subunitsReplication, recombination and repair [L] 4.35
COG2980Outer membrane lipoprotein LptE/RlpB (LPS assembly)Cell wall/membrane/envelope biogenesis [M] 4.35
COG0268Ribosomal protein S20Translation, ribosomal structure and biogenesis [J] 0.87
COG0802tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaETranslation, ribosomal structure and biogenesis [J] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459024|GZRSKLJ01BDJM6All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7502Open in IMG/M
3300001084|JGI12648J13191_1034234All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300004092|Ga0062389_104701210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter514Open in IMG/M
3300004153|Ga0063455_100877175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300005187|Ga0066675_10684298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300005434|Ga0070709_10389466All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1038Open in IMG/M
3300005439|Ga0070711_100382764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1138Open in IMG/M
3300005439|Ga0070711_101905962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter522Open in IMG/M
3300005542|Ga0070732_10126390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1516Open in IMG/M
3300005542|Ga0070732_10260090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1040Open in IMG/M
3300005566|Ga0066693_10258604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter690Open in IMG/M
3300005587|Ga0066654_10354456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300005591|Ga0070761_10959042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter542Open in IMG/M
3300005903|Ga0075279_10055844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300005921|Ga0070766_10042575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2523Open in IMG/M
3300005938|Ga0066795_10085735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300006028|Ga0070717_12050517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300006031|Ga0066651_10827666All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300006050|Ga0075028_100194909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1091Open in IMG/M
3300006172|Ga0075018_10398082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300006173|Ga0070716_100890068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300006173|Ga0070716_100914027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300006174|Ga0075014_100259788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium900Open in IMG/M
3300006354|Ga0075021_10079663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1925Open in IMG/M
3300006755|Ga0079222_10668083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300006804|Ga0079221_11650272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300006881|Ga0068865_101739875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300006914|Ga0075436_100843473All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300009551|Ga0105238_11937329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300009759|Ga0116101_1071349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300010046|Ga0126384_11557403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300010048|Ga0126373_11353682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300010303|Ga0134082_10284294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300010329|Ga0134111_10276492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300010361|Ga0126378_10036822All Organisms → cellular organisms → Bacteria4445Open in IMG/M
3300010376|Ga0126381_103886978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300010379|Ga0136449_100716347All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1674Open in IMG/M
3300011119|Ga0105246_12092564All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300011269|Ga0137392_10077104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2580Open in IMG/M
3300011269|Ga0137392_11035363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300012096|Ga0137389_10907116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300012212|Ga0150985_107291336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300012212|Ga0150985_108540864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300012354|Ga0137366_11052666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300012918|Ga0137396_10233373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1356Open in IMG/M
3300012960|Ga0164301_11492314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300012971|Ga0126369_11694964All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300012987|Ga0164307_10989756All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300013297|Ga0157378_10552734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300014654|Ga0181525_10331800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium832Open in IMG/M
3300014657|Ga0181522_10061195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2132Open in IMG/M
3300014658|Ga0181519_10318376All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium965Open in IMG/M
3300015262|Ga0182007_10138814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300015372|Ga0132256_103636282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300016341|Ga0182035_11985317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300016357|Ga0182032_11106508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300016404|Ga0182037_10160315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1706Open in IMG/M
3300017929|Ga0187849_1315546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300017933|Ga0187801_10003137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5099Open in IMG/M
3300017936|Ga0187821_10274408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300018038|Ga0187855_10677512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300018085|Ga0187772_10845519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300018088|Ga0187771_10303225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1338Open in IMG/M
3300020579|Ga0210407_10439989All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1020Open in IMG/M
3300020580|Ga0210403_11327013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300021180|Ga0210396_10588878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300021180|Ga0210396_10964829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300021401|Ga0210393_10857882All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300021420|Ga0210394_11401627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300021433|Ga0210391_10187357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1628Open in IMG/M
3300022724|Ga0242665_10149573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300024271|Ga0224564_1137282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300026075|Ga0207708_10671673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300026294|Ga0209839_10085309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1093Open in IMG/M
3300026324|Ga0209470_1251708All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300026548|Ga0209161_10206799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1077Open in IMG/M
3300026548|Ga0209161_10548655All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300027080|Ga0208237_1052770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300027570|Ga0208043_1107447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300027692|Ga0209530_1008103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3344Open in IMG/M
3300027853|Ga0209274_10016127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3377Open in IMG/M
3300027862|Ga0209701_10296665All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300027874|Ga0209465_10013000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3738Open in IMG/M
3300027879|Ga0209169_10662368All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300027884|Ga0209275_10130363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1316Open in IMG/M
3300028560|Ga0302144_10280013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300028773|Ga0302234_10217586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300028863|Ga0302218_10148887All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300029954|Ga0311331_11202310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300030000|Ga0311337_10891194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300030045|Ga0302282_1103044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1178Open in IMG/M
3300030057|Ga0302176_10324645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300030490|Ga0302184_10430224All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300030618|Ga0311354_10032074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6310Open in IMG/M
3300030646|Ga0302316_10173390All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300030706|Ga0310039_10027189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2687Open in IMG/M
3300030759|Ga0265745_1019948All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300030814|Ga0265741_100381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2246Open in IMG/M
3300031708|Ga0310686_118979923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300031716|Ga0310813_10202974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1627Open in IMG/M
3300031718|Ga0307474_10286910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1266Open in IMG/M
3300031753|Ga0307477_10423316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300031820|Ga0307473_11306269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300031823|Ga0307478_10034348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3680Open in IMG/M
3300031890|Ga0306925_10359194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1564Open in IMG/M
3300032160|Ga0311301_10847974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1243Open in IMG/M
3300032174|Ga0307470_10384394All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300032205|Ga0307472_101253062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300032829|Ga0335070_10094541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3143Open in IMG/M
3300032829|Ga0335070_12078114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300032893|Ga0335069_10069815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4524Open in IMG/M
3300033004|Ga0335084_10526538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1213Open in IMG/M
3300033134|Ga0335073_10210065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2406Open in IMG/M
3300033433|Ga0326726_12297929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300033829|Ga0334854_015881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1822Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.22%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.22%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.35%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.48%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.74%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.74%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.74%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.87%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.87%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027080Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030759Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030814Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD1_088521202170459024Grass SoilSKPVLFVIALTYMFSGIFWRLHWFFRRNRNTPPPTYKEASQTS
JGI12648J13191_103423413300001084Forest SoilALSYMFSGVFWRLQWIFRRKRNPSPPQYKEASQTS*
Ga0062389_10470121023300004092Bog Forest SoilFSQWVLFVIALTYMFSGVFWRLQWIFRRKRNPPPPQYKEASQTS*
Ga0063455_10087717523300004153SoilSRNVLFAIALLYMVSGVFWRLQWIFRRRSGPAPPYNEASQAS*
Ga0066675_1068429813300005187SoilWVLFAIALLYMFSGVVWRLQWIFRRKGGPPSPPAYKEASQTS*
Ga0070709_1038946623300005434Corn, Switchgrass And Miscanthus RhizosphereLFFIALLYTISGVFWRVQWIFRRKSDPPPPTYKEASQTS*
Ga0070711_10038276423300005439Corn, Switchgrass And Miscanthus RhizosphereFSQQMLFALALLYMASGVFWRLQWIFRRRETPPPAAYKEASQT*
Ga0070711_10190596223300005439Corn, Switchgrass And Miscanthus RhizosphereWVLFLIALLYLFSGVFWRLKWIFRRKGNPPPPPAYTEASQPS*
Ga0070732_1012639033300005542Surface SoilWHRPLLFGIALLYMFSGVWWRLQWLFRRRPSPPAPPVYKEASHTA*
Ga0070732_1026009023300005542Surface SoilALLYMVSGIFWRLQWIFRRRGRRPPPPYKEASQAS*
Ga0066693_1025860433300005566SoilALALLYMASGVFWRLQWIFRRRETPPPAAYKEASQT*
Ga0066654_1035445623300005587SoilQQVLFAVALLYMVSGVFWRVQWIFRRRSGPPPPPFQEASHA*
Ga0070761_1095904213300005591SoilLFVIALSYMFSGVFWRLQWIFRRKRNPPPPQYKEASQIS*
Ga0075279_1005584423300005903Rice Paddy SoilEPLLFSIALLYMASGIFWRLQWIFRRKGSPPAPPSYREASQTS*
Ga0070766_1004257513300005921SoilFSGPALFALALLYTFSGVFWRLQWMFRRKSTPPPPPYHEASQTS*
Ga0066795_1008573523300005938SoilPALFAIAILYMASGVLWRLQWIFRRKTPPAPPPYREASPTP*
Ga0070717_1205051723300006028Corn, Switchgrass And Miscanthus RhizosphereASEWVLFLIAIFYMFSGILWRLQWLFRRKGNPPPPPAYKEASQPS*
Ga0066651_1082766613300006031SoilRKVLFGIALLYMVSGVFWRLQWIFRRRSGPPPPSYKEASQAS*
Ga0075028_10019490923300006050WatershedsLYMFSGVLWRLQWIFRRKRNPPPPPAYKEISQTS*
Ga0075018_1039808213300006172WatershedsVIALLYMFSGVLWRLQWIFRRKRNPPPPPAYKEISQTS*
Ga0070716_10089006813300006173Corn, Switchgrass And Miscanthus RhizosphereMLFALALLYMASGVFWRLQWIFRRRETPPPAAYKEASQT*
Ga0070716_10091402723300006173Corn, Switchgrass And Miscanthus RhizosphereLFALSLLYMASGVFWRLQWLFRRKGSPPPPPYQEASQIS*
Ga0075014_10025978813300006174WatershedsLYVLSGVFWRLKWIFRRKGSSPPPPAYTEASQTS*
Ga0075021_1007966343300006354WatershedsLFAIAVLYMASGVLWRLQWIIRRKNPPAPPPYREASQTS*
Ga0079222_1066808313300006755Agricultural SoilQMLFALALLYMASGVFWRLQWIFRRRETPPPAAYNEASQT*
Ga0079221_1165027223300006804Agricultural SoilFVIALTYMLSGIFWRLHWLFRRKRNPPPPPYTEASQTS*
Ga0068865_10173987513300006881Miscanthus RhizospherePIVLFAIALLYTFSGVFWRLKWLLRRKNNPPPPNYKEASQTS*
Ga0075436_10084347313300006914Populus RhizosphereLFAIALLYMASGVFWRLQWIFRRRSGPPPPSYKEASQAS*
Ga0105238_1193732923300009551Corn RhizospherePLLFVLALTYMFSGVFWRLQWILRRKGPPSPPAYKEASQIS*
Ga0116101_107134923300009759PeatlandIALLYMISGVFWRLQWIFRRRPDPPPPSYKEVSQAS*
Ga0126384_1155740323300010046Tropical Forest SoilVLFAIALLYTFSGVLWRLQWLFRRRGGPPTPPAYREASQTS*
Ga0126373_1135368223300010048Tropical Forest SoilLFAIALLYMASGVFWRLQWIFRRRSDPPPPSYKEASQAS*
Ga0134082_1028429423300010303Grasslands SoilVLFAIALLYMFSGVVWRLQWIFRRKGGPPSPPAYKEASQTS*
Ga0134111_1027649213300010329Grasslands SoilRYVLFAIALLYMFSGVFWRLTWIFRRRNPPPPAYKEASLPS*
Ga0126378_1003682273300010361Tropical Forest SoilQVLFVIALTYMFSGVFWRLHWIFRRHRNPPPPPYREATEVS*
Ga0126381_10388697813300010376Tropical Forest SoilLFVIALTYMFSGIFWRLHWTFRRRGNEPPPPYTQASPVS*
Ga0136449_10071634713300010379Peatlands SoilRQVLFFIALFYMISGVFWRVQWIFRRHHDPPPPPYKEASPAS*
Ga0105246_1209256423300011119Miscanthus RhizosphereIALLYMVSGVFWRLQWIFRRRSGPPPPSYKEAPHAS*
Ga0137392_1007710443300011269Vadose Zone SoilLLFSIALLYMFSGVFWRLQWIFRRRNQPPPPSYKEASQVS*
Ga0137392_1103536323300011269Vadose Zone SoilVALLYMVSGVFWRLQWIFRRRRGPPPPSYKEASQAS*
Ga0137389_1090711623300012096Vadose Zone SoilYYSGPALFVIAILYMASGVLWRLQWIFHRKSPPAPPAYREASQTP*
Ga0150985_10729133623300012212Avena Fatua RhizosphereFALALLYMASGVFWRLQWIFRRRETPPAYTEASRAQ*
Ga0150985_10854086423300012212Avena Fatua RhizosphereLFVLALTYMFSGVFWRLQWILRRKGPPSPPAYKEASQIS*
Ga0137366_1105266623300012354Vadose Zone SoilGPLLFAIALLYMFSGVFWRLQWVFRRRSNPPPPPAYKEASQTS*
Ga0137396_1023337323300012918Vadose Zone SoilGIALIYMFSGVLWRLQWIIRRRPRPPIPPAYEEASQPS*
Ga0164301_1149231423300012960SoilFAIALIYMFSGVLWRLQWIIRRKPSPPAPPAYKEASQPS*
Ga0126369_1169496413300012971Tropical Forest SoilLIYMFSGVWWRLQWIVRRKPSPPAPPAYKEASQPS*
Ga0164307_1098975613300012987SoilRRVLFGLALLYMVSGVFWRLQWIFRRRSGPPPPSYKEAPHAS*
Ga0157378_1055273423300013297Miscanthus RhizosphereVLFLIALLYVFSGVFWRLKWIFRRKSDPPPPPTYTEAPQAS*
Ga0181525_1033180013300014654BogALFALALFYTFSGVFWRLQWMFRRKSTPPPPPYHEASQTS*
Ga0181522_1006119513300014657BogLFAIAIVYMASGVLWRLQWIFRRKSPPAPPAYREASQTP*
Ga0181519_1031837623300014658BogVLFIVALTYMFSGVLMRLGYVFRRRSGPPPPPSYTEASDLP*
Ga0182007_1013881413300015262RhizosphereLFGIALLYMVSGVFWRLQWIFRRRSGPPPPSYKEAPRAS*
Ga0132256_10363628213300015372Arabidopsis RhizosphereALIYMFSGVLWRLQWIIRRRPQPPAPPVYKEASQPS*
Ga0182035_1198531713300016341SoilLALLYMTSGVFWRLQWIFRRRSGPPPPPYKEASQTS
Ga0182032_1110650823300016357SoilVLFALALLYMVSGVFWRLQWIFRHRPGPPPPTYKEASQIS
Ga0182037_1016031513300016404SoilQRVLFAVALLYMFSGVLWRLQWIIRRRPSPPSPPAPAYKEASQPS
Ga0187849_131554623300017929PeatlandSRQILFAIAVLYMASGVLWRLQWIFHRKAPPAPPVNREASQNP
Ga0187801_1000313773300017933Freshwater SedimentVLFIIALTYMFSGVFWRLQWIFRRKRNPPPPPYKEASQTS
Ga0187821_1027440823300017936Freshwater SedimentALLYTVSGVFWRLQWIFRRRSGPTPPSYKEAPQAR
Ga0187855_1067751223300018038PeatlandALFALALFYTFSGVFWRLQWMFRPKSTPPPPPYHEASQTS
Ga0187772_1084551913300018085Tropical PeatlandRPMLFGIALLYMVSGVFWRLQWIFRKRTNPPPPPHFKEVSQAS
Ga0187771_1030322513300018088Tropical PeatlandRLLLFVIELAYMASGVLWRLQWIFRKKGNPPPPPYTEARQTS
Ga0210407_1043998913300020579SoilFFSRQLLFVLALTYMASGVIWRLQWLFRRRSDPPPPAPTYKEASQPS
Ga0210403_1132701313300020580SoilFFSKPALFGVALLYTFSGVFWRLQWMFRRRNQPPPPTYTEASQTS
Ga0210396_1058887813300021180SoilLFGVALLYTFSGVFWRLQWIFRRRNQPPPPPYKEASQIS
Ga0210396_1096482913300021180SoilLSIALLYMFSGVWWRLQWLFRRRPSPPAPPVYKEASHTA
Ga0210393_1085788213300021401SoilFSRQMLFVIALFYMVSGVFWRVQWIFRRRNNPPPPPYKEASQAS
Ga0210394_1140162723300021420SoilFMFHRKVLFGLALFYMISGIFWRVQWIFRRKTDLPPPPPYKEAPQA
Ga0210391_1018735713300021433SoilRPTLFCVALLYMFSGVFWRLQWIFRRRGQTPPPTYKEASQTS
Ga0242665_1014957313300022724SoilRWVLFAIAIIYMSSGVLWRLQWIIRRRPSPPAPPVYKEASQPS
Ga0224564_113728223300024271SoilWVLFVIALTYMLSGVFWRMQWIFRRKRNPPPPSYREASQTS
Ga0207708_1067167313300026075Corn, Switchgrass And Miscanthus RhizosphereAIALLYTFSGVFWRLKWLLRRKNNPPPPNYKEASQTS
Ga0209839_1008530923300026294SoilIALIYTVSGVFWRLQWMFRRKHNRPPPPYKEASQTS
Ga0209470_125170823300026324SoilIALLYMFSGVVWRLQWIFRRKGGPPSPPAYKEASQTS
Ga0209161_1020679913300026548SoilVLFAIALLYMFSGVVWRLQWIFRRKGGPPSPPAYKEASQTS
Ga0209161_1054865513300026548SoilLFSRLALFIIAIVYMASGVLWRLQWIFHRKTPPAPPAYREASHTP
Ga0208237_105277013300027080Forest SoilALFGVALLYTFSGVFWRLQWMFRRRNQPPPPTYTEASQTS
Ga0208043_110744723300027570Peatlands SoilYLLFVLALTYMASGVVWRLLWIFRRKNTPPPSYKEASQTS
Ga0209530_100810313300027692Forest SoilAIAILYMASGVLWRLQWIFHRKTPPAPPPYREASQNP
Ga0209274_1001612713300027853SoilALLYTFSGVFWRLQWMFRRKSTPPPPPYHEASQTS
Ga0209701_1029666513300027862Vadose Zone SoilGPVLFGVALLYTFSGVFWRLQWMFRRRNQPPPPTYKEASQTS
Ga0209465_1001300063300027874Tropical Forest SoilAVALLYMVSGVFWRLQWIFRRRSDPPPPSYKEASQAS
Ga0209169_1066236823300027879SoilLFAIAIVYMASGVLWRLQWIFRRKTPPAPPAYREASQTP
Ga0209275_1013036333300027884SoilPALFGVALLYTFSGVFWRLQWIFRRRNQPPPPPYKEASQIS
Ga0302144_1028001323300028560BogGVAAFSGPVLFGIALLYMFSGVFWRLQWIFRRKNPPPPPYKEASQTS
Ga0302234_1021758623300028773PalsaGPVLFGIALLYMFSGVFWRLQWIFRRKNPPPPPYKEASQTS
Ga0302218_1014888713300028863PalsaSKPVLFGVALLYTFSGVFWRLQWIFRRRNQPPPPAYKEASQTS
Ga0311331_1120231013300029954BogLFAIALLYTFSGVFWRLQWMFRRRNQPPPPTYKEASQTS
Ga0311337_1089119413300030000FenIGYFSRPVLFAIAILYMASGVLWRLQWIFRRKNPPAPPAYREASQTS
Ga0302282_110304423300030045FenAFSGPVLFGIALLYMFSGVFWRLQWIFRRKNPPPPPYKEASQTS
Ga0302176_1032464513300030057PalsaLFAIALLYMFSGVFWRLQWIFRRRNQPPPPAYKEAPQTS
Ga0302184_1043022423300030490PalsaSKPVLFGVALLYTFSGVFWRLQWMFRRRNQPPPPAYKEASQTS
Ga0311354_1003207413300030618PalsaFSGPALFVIAILYMASGVLWRLQWIFHRKTSPPAPPVYHEASHTP
Ga0302316_1017339023300030646PalsaFGVALLYTFSGVFWRLQWIFRRRNQPRPPTYKEVSQTS
Ga0310039_1002718913300030706Peatlands SoilIALTYMLSGVFWRMQWIFRRKRNPPPPSYREASQTS
Ga0265745_101994823300030759SoilIFAFSGPALFALALLYTFSGVFWRLQWMFRRKSTPPPPPYHEASQTS
Ga0265741_10038143300030814SoilSGPALFALALFYTFSGVFWRLQWMFRRKSTPPPPPYHEASQTS
Ga0310686_11897992323300031708SoilFSGPALFALALFYTFSGVFWRLQWMFRRKSTPPTPPYHEASQTS
Ga0310813_1020297413300031716SoilFSRRVLFAIALLYMVSGVFWRLQWIFRRRPGPPPPSYKEAPHTS
Ga0307474_1028691013300031718Hardwood Forest SoilFGVALLYTFSGVFWRLQWMFRRRNQPPPPPFKEASQTS
Ga0307477_1042331613300031753Hardwood Forest SoilFAVALLYMVSGVFWRVQWIFRRRSGPPPPPYKEASQAS
Ga0307473_1130626923300031820Hardwood Forest SoilLFGMALLYMFSGVIWRLMWIFRRRGGTPPPTYKEASQIS
Ga0307478_1003434813300031823Hardwood Forest SoilRKVLFAIALLYTISGVFWRVQWIFRRKTGPPQPPYKEASQAS
Ga0306925_1035919433300031890SoilFAVALLYMFSGVLWRLQWIIRRRPSPPSPPAPAYKEASQPS
Ga0311301_1084797413300032160Peatlands SoilFLIALLYMVSGLFWRLQWMFRRRNDPPPPPYKEASQTS
Ga0307470_1038439413300032174Hardwood Forest SoilFSRKMLFAIALLYMVSGVFWRLQWIFRRRSGPPPPSYKEAPQAR
Ga0307472_10125306223300032205Hardwood Forest SoilSRFVLFGIALLYMFSGVFWRLQWIFRRRNNPPPPAFREASQTS
Ga0335070_1009454113300032829SoilVLLFVIALAYMSSGVIWRLQWVFRRKGSNPPPPPFKEVSQTS
Ga0335070_1207811413300032829SoilFSRYVLFGIALLYMFSGVLWRLQWIFRRRGNPPPPAYREASQPS
Ga0335069_1006981513300032893SoilFSGPVLFAIAVLYMASGILWRLQWIFRRKAPPAPPPTHPASVTS
Ga0335084_1052653823300033004SoilVFSGPVLFAIALLYMVSGVFWRLQWIFRRRSGPPPPSYKEAPHVS
Ga0335073_1021006543300033134SoilALLYMVSGVFWRLQWIFRKRSNPPPPPRYKEASQAS
Ga0326726_1229792913300033433Peat SoilIALLYMFSGVLWRIQWIFRRKTNPPPPAYKEASQTS
Ga0334854_015881_1_1173300033829SoilIFIALGYMLSGVFWRLQWVFRRKGTSPPSGYKEVSQTS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.