NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080378

Metagenome / Metatranscriptome Family F080378

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080378
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 56 residues
Representative Sequence AALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE
Number of Associated Samples 106
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.26 %
% of genes from short scaffolds (< 2000 bps) 86.96 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.19

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.826 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.478 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.19
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00990GGDEF 4.35
PF00072Response_reg 0.87
PF02576RimP_N 0.87
PF06724DUF1206 0.87
PF07676PD40 0.87
PF04998RNA_pol_Rpb1_5 0.87
PF02082Rrf2 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0086DNA-directed RNA polymerase, beta' subunit/160 kD subunitTranscription [K] 0.87
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.87
COG0779Ribosome maturation factor RimPTranslation, ribosomal structure and biogenesis [J] 0.87
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.87
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.87
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.87
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.87
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.87
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.87
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.17 %
UnclassifiedrootN/A7.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100646870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1697Open in IMG/M
3300000956|JGI10216J12902_100296609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300000956|JGI10216J12902_106862146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300000956|JGI10216J12902_114570444Not Available1150Open in IMG/M
3300002568|C688J35102_120486542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1109Open in IMG/M
3300002908|JGI25382J43887_10446949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300004081|Ga0063454_101220601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria624Open in IMG/M
3300004156|Ga0062589_101250450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300004479|Ga0062595_101064613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300004479|Ga0062595_101526135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300005093|Ga0062594_101985445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005162|Ga0066814_10107942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300005169|Ga0066810_10118255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300005172|Ga0066683_10682820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300005179|Ga0066684_10060126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2213Open in IMG/M
3300005187|Ga0066675_10051897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2528Open in IMG/M
3300005187|Ga0066675_10127143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1722Open in IMG/M
3300005332|Ga0066388_105201795Not Available660Open in IMG/M
3300005347|Ga0070668_100257004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1452Open in IMG/M
3300005435|Ga0070714_101170510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria750Open in IMG/M
3300005437|Ga0070710_11205710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300005444|Ga0070694_101416939Not Available587Open in IMG/M
3300005450|Ga0066682_10246115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1150Open in IMG/M
3300005457|Ga0070662_100172456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1700Open in IMG/M
3300005471|Ga0070698_100925367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300005540|Ga0066697_10047836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2418Open in IMG/M
3300005543|Ga0070672_100120058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2151Open in IMG/M
3300005545|Ga0070695_101650069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300005553|Ga0066695_10204027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1241Open in IMG/M
3300005556|Ga0066707_10994450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300005569|Ga0066705_10224967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300005587|Ga0066654_10775653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300005598|Ga0066706_10338607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300006031|Ga0066651_10450760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300006032|Ga0066696_10383970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300006032|Ga0066696_11098676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300006046|Ga0066652_101609908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300006058|Ga0075432_10009779All Organisms → cellular organisms → Bacteria3262Open in IMG/M
3300006173|Ga0070716_101182078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300006186|Ga0075369_10519580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300006791|Ga0066653_10283441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria839Open in IMG/M
3300006804|Ga0079221_11594736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300006806|Ga0079220_10288085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1007Open in IMG/M
3300006903|Ga0075426_10265223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1252Open in IMG/M
3300006953|Ga0074063_13236357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300007255|Ga0099791_10637163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300009012|Ga0066710_102167887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300009137|Ga0066709_102800785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300009162|Ga0075423_13077392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300009553|Ga0105249_12926973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300009792|Ga0126374_11612799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300010041|Ga0126312_11214175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300010325|Ga0134064_10364715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300010396|Ga0134126_12735581Not Available535Open in IMG/M
3300010399|Ga0134127_13622271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300012198|Ga0137364_10280885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300012200|Ga0137382_10578160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300012224|Ga0134028_1167389Not Available523Open in IMG/M
3300012285|Ga0137370_10261893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1026Open in IMG/M
3300012383|Ga0134033_1137813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1003Open in IMG/M
3300012512|Ga0157327_1091549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300012914|Ga0157297_10180592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300012951|Ga0164300_10242465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300012958|Ga0164299_11327738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012960|Ga0164301_10380194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300013296|Ga0157374_10437818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1307Open in IMG/M
3300013296|Ga0157374_10463884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1268Open in IMG/M
3300013768|Ga0120155_1018030Not Available2366Open in IMG/M
3300014157|Ga0134078_10075788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1216Open in IMG/M
3300014166|Ga0134079_10097842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1116Open in IMG/M
3300014488|Ga0182001_10405993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300014497|Ga0182008_10894323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300015371|Ga0132258_13689157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300015372|Ga0132256_103327809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300017654|Ga0134069_1017521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2129Open in IMG/M
3300017947|Ga0187785_10595231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300018028|Ga0184608_10025315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2193Open in IMG/M
3300018064|Ga0187773_10940304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300018431|Ga0066655_11240876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300018469|Ga0190270_10523572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1136Open in IMG/M
3300018482|Ga0066669_10907734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria789Open in IMG/M
3300019208|Ga0180110_1088750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300019878|Ga0193715_1021371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1406Open in IMG/M
3300020215|Ga0196963_10327164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300021418|Ga0193695_1099838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300022694|Ga0222623_10140506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria940Open in IMG/M
3300022694|Ga0222623_10251743Not Available682Open in IMG/M
3300025905|Ga0207685_10803057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium518Open in IMG/M
3300025929|Ga0207664_10650739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300025939|Ga0207665_10874561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300026075|Ga0207708_10976020Not Available735Open in IMG/M
3300026121|Ga0207683_11423803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300026552|Ga0209577_10108929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2234Open in IMG/M
3300027523|Ga0208890_1058375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300028712|Ga0307285_10188172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300028717|Ga0307298_10012809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2113Open in IMG/M
3300028718|Ga0307307_10012515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2270Open in IMG/M
3300028719|Ga0307301_10175812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300028720|Ga0307317_10082906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1052Open in IMG/M
3300028721|Ga0307315_10139610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300028722|Ga0307319_10290716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300028771|Ga0307320_10211697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300028784|Ga0307282_10023146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2631Open in IMG/M
3300028784|Ga0307282_10040606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2047Open in IMG/M
3300028784|Ga0307282_10316067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300028796|Ga0307287_10129573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria956Open in IMG/M
3300028799|Ga0307284_10095946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1104Open in IMG/M
3300028807|Ga0307305_10274771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300028876|Ga0307286_10353146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300031716|Ga0310813_10451816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300031720|Ga0307469_10085120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2158Open in IMG/M
3300031908|Ga0310900_11034224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300032122|Ga0310895_10081980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1271Open in IMG/M
3300032180|Ga0307471_104111384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil18.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.35%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.87%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10064687023300000364SoilGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
JGI10216J12902_10029660923300000956SoilIGGDGGDGASLAGLGLDFGGTPDFGEENPPDEEVEAEEIPEVDTPLDES*
JGI10216J12902_10686214623300000956SoilIGGDGGDGASLAGLGLDFGGTPDFGEENPPNEEVEAEEIPEVDTPLDES*
JGI10216J12902_11457044423300000956SoilEREQLLAALEEIGSDGGDGLDLASLGLDFGGQPDVNDEGKPRESTEAEEVPEVDSPLDGE
C688J35102_12048654223300002568SoilSEKVPAESYEREALLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPKEELEAEEVPEVDTPLDEG*
JGI25382J43887_1044694913300002908Grasslands SoilEKVPAETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPDEEVEAEEIPEVDTPLDEG*
Ga0063454_10122060123300004081SoilIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0062589_10125045023300004156SoilKVPKEAYERETLLAALQEIGTDGGSIDLSSLGLDFGGQPDVGNDEAKPKTDLEAEEIPEVDSPLDD*
Ga0062595_10106461323300004479SoilKVPKEAYERETLLAALQEIGTDGGNIDLSSLGLDFGGQPDVGNDEAKPKTDLEAEEIPEVDSPLDD*
Ga0062595_10152613523300004479SoilKVPKETYEREALLAALQEIDSDGGDGIDLASLGLDFGGEPTDNDQAKPQESTEAEEVPEVDSPLDGE*
Ga0062594_10198544513300005093SoilQEIGTDGGNIDLSSLGLDFGGQPDVGNDEAKPKTDLEAEEIPEVDSPLDD*
Ga0066814_1010794213300005162SoilGLDLASLGLDFGAGDGGETNGEPKRPATEPDEVPEVDKPLDE*
Ga0066810_1011825513300005169SoilALEEIGSDGGEGLDLASLGLDFGDGGETDGEAKRPSTEADEVPEVDTPLDE*
Ga0066683_1068282023300005172SoilEEIGSDGGEGIDLASLGLDFGGGPEPTDGDTKPHESTEAEEVPEVDTPLNGE*
Ga0066684_1006012633300005179SoilLLAALQEIGGEGGDGASLANLGLDFGGTPDFGEENAPREEPEAEEIPEVDSPLDES*
Ga0066675_1005189733300005187SoilLAALQEIGGDGGDGASLASLGLDFGGTPDFGEDNPPKEEGEAEEIPEVDTPLDES*
Ga0066675_1012714323300005187SoilTEEQLLAALEEIGSDGGDGVDLASLGLDFGGQPDQNDEAKPHESTEAEEVPEVDTPLDE*
Ga0066388_10520179523300005332Tropical Forest SoilMLISAEKVRGPIEISPSGKVPAEAYEREALLAALQEIGVDGGHCASLASLGLDFGGTPDLGEGNPPKEAEEAGEIPEVDSPLDA
Ga0070668_10025700413300005347Switchgrass RhizosphereLQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0070714_10117051023300005435Agricultural SoilLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0070710_1120571013300005437Corn, Switchgrass And Miscanthus RhizosphereQEIGGDGGDGASLASLGLDFGGTPDFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0070694_10141693923300005444Corn, Switchgrass And Miscanthus RhizosphereKVPKEAYERETLLAALQEIGSDGGGMDLGSLGLDFGGQPDLNDEAKPREATEAEEIPED*
Ga0066682_1024611513300005450SoilEIGSDGGDGLDLASRGLDFGGQPDTNDEGKPKESTEAEEVPEVDSPLDEA*
Ga0070662_10017245623300005457Corn RhizosphereLLAALQEIGSDGGEGIDLASLGLDFGGGPEPTDGDPKPHESTEAEEVPEVDTPLDGE*
Ga0070698_10092536713300005471Corn, Switchgrass And Miscanthus RhizosphereETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0066697_1004783613300005540SoilAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE*
Ga0070672_10012005833300005543Miscanthus RhizosphereALQEIGSDGGEGIDLASLGLDFGGGPEPTDGDPKPHESTEAEEVPEVDTPLDGE*
Ga0070695_10165006923300005545Corn, Switchgrass And Miscanthus RhizosphereDGGDGASLASLGLDFGGTPDFGEENPPDEEVEAEEIPEVDTPLDEG*
Ga0066695_1020402723300005553SoilIGGDGGDGANLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE*
Ga0066707_1099445023300005556SoilAETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE*
Ga0066705_1022496713300005569SoilALQEIGGEGGDGASLANLGLDFGGTPDFGEENAPREEPEAEEIPEVDSPLDES*
Ga0066654_1077565313300005587SoilEIGGNGGDAASLASLGLDFGGTPDYGEENPPKEDGEAEEIPEVDTPLDEG*
Ga0066706_1033860713300005598SoilAETYEREALLAALQEIGGDGGDGANLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDES*
Ga0066651_1045076023300006031SoilLAALEEIGSDGGDGVDLASLGLDFGGEPETDGESKPRESTEAEEVPEVETPLDHE*
Ga0066696_1038397013300006032SoilALEEIGSDGGDGVDLASLGLDFGGQPDQNDEAKPHESTEAEEVPEVDTPLDE*
Ga0066696_1109867613300006032SoilLLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE*
Ga0066652_10160990823300006046SoilDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0075432_1000977913300006058Populus RhizosphereIEISPSEKVPAETYEREALLAALQEIGGDGGDGASLAGLGLDFGGTPDFGEENPPNEEVEAEEIPEVDTPLDES*
Ga0070716_10118207813300006173Corn, Switchgrass And Miscanthus RhizosphereSEKVPAETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0075369_1051958013300006186Populus EndospherePSEKVPKEAYERETLLAALQEIGTDGGSIDLSSLGLDFGGQPDLNDEAKPKESGEAEEVTEVDSPLDD*
Ga0066653_1028344113300006791SoilEREALLAALQEIGGNGGDAASLASLGLDFGGTPDYGEENPPKEDGEAEEIPEVDTPLDEG
Ga0079221_1159473613300006804Agricultural SoilPADTYEREALLAALQEIGGDGGDGASLAGLGLDFGGTPDFGEENPPNPSAEAEEIPEVDTPLDEG*
Ga0079220_1028808523300006806Agricultural SoilDGGDGIDLASLGLDFGGGPEPTDGDPKPRESTEAEEVPEVDSPLDGE*
Ga0075426_1026522323300006903Populus RhizosphereALLAALQEIGSDGGDGIDLASLGLDFGGGPEPTDGDPKPHESTEAEEVPEVDTPLDGE*
Ga0074063_1323635723300006953SoilDSDGGEGLDLASLGLDFGDGEGGETNGEPKRPTTEADEVPEVDKPLDE*
Ga0099791_1063716323300007255Vadose Zone SoilGGDGGDGASLASLGLDFGGTPDFGEENPPDEEVEAEEIPEVDTPLDEG*
Ga0066710_10216788723300009012Grasslands SoilAALEEIDSDGAAGLDLEGLDFGGQPGLNDEAKPHEAGEAEEIPEADSPE
Ga0066709_10280078513300009137Grasslands SoilISPSEKVPAETYEREALLAALQEIGGDGGDGASLAGLGLDFGGTPDFGEENPPKEEVEAEEIPEVDTPLDES*
Ga0075423_1307739223300009162Populus RhizosphereAALEEIGSDGGEGIDLASLGLDFGGEPETNGEPAARESTEAEEVPEVDTPLDE*
Ga0105249_1292697323300009553Switchgrass RhizosphereKVPAETYESEPLLAALQEIGGDGGDGASIASPGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDEG*
Ga0126374_1161279913300009792Tropical Forest SoilSDGGDGLNLESLGLDFGGQPDVDAGATHEAGEAEEVPEIDSPLDGE*
Ga0126312_1121417523300010041Serpentine SoilGSDGGDGIDLASLGLDFGGAPETTDGDTTPRESTEAEEVPEVDTPLEGE*
Ga0134064_1036471513300010325Grasslands SoilLLAALQEIGGNGGDAASLASLGLDFGGTPDYGEENPPKEDGEAEEIPEVDTPLDEG*
Ga0134126_1273558113300010396Terrestrial SoilERETLLAALQEIGSDGGNIDLASLGLDFGGQPDLNDEGKPKESTEAEEVPEVDSPLDES*
Ga0134127_1362227123300010399Terrestrial SoilTDGGEGVDLASLGLDFGGAPEPSAPENGGNAKPRESTEAEEVPEVDTPLDGE*
Ga0137364_1028088523300012198Vadose Zone SoilGTDGGDGLGLAGLGLDFGGQPETDGEPKPRESTEAEEVPEVDSPIDE*
Ga0137382_1057816013300012200Vadose Zone SoilEREALLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDES
Ga0134028_116738923300012224Grasslands SoilLAALEEIGSDGGDGLDLASLGLDFGGQPDLNDEGKPKESTEAEEVPEVDSPLDE*
Ga0137370_1026189313300012285Vadose Zone SoilDGGDGAILASLGLDFGGTPDFGEENPLKEEGEAEEIPEVDTPLDES*
Ga0134033_113781313300012383Grasslands SoilVPAETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE*
Ga0157327_109154923300012512Arabidopsis RhizosphereEALLAALEEIGSDGGEGIDLASLGLDFGGEPETNGEPAARESTEAEEVPEVDTPLDE*
Ga0157297_1018059213300012914SoilEALLAALQEIDSDGGDGIDLASLGLDFGGEPTENDQAKPQESTEAEEVPEVDSPLDGD*
Ga0164300_1024246523300012951SoilEKVPKETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEIEAEEVPEVDTPLDEG*
Ga0164299_1132773813300012958SoilDGGDGASLASLGLDFGGTPDYGEENPPKEEGEAEEIPEVDTPLDES*
Ga0164301_1038019423300012960SoilAALQEIGSDGGDGIDLASLGLDLGGGRALTDGDPKPHESTEAEEVPEVDTPLDGE*
Ga0157374_1043781823300013296Miscanthus RhizosphereAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES*
Ga0157374_1046388423300013296Miscanthus RhizosphereEIGSEGGEGIDLASLGLDFGGEPETNAEPAARESTEAEEVPEVDTPLDGE*
Ga0120155_101803013300013768PermafrostRQLVAALEEIGSDGDTELGLGAFGMDFGGQPELNDEAKPQESGEAEEIPEVDTPLDAE*
Ga0134081_1011606013300014150Grasslands SoilMRPATEEQLLAALEEIDSDGGDGLNLESLGLDFGGQPGVEDGGVSHESGEATEVPEVDTPLDEA*
Ga0134078_1007578823300014157Grasslands SoilAALQEIGGDGGDGASLAGLGLDFGGTPDFGEENPPKEEVEAEEIPEVDTPLDES*
Ga0134079_1009784223300014166Grasslands SoilSEKVPAETYEREALLAALQEIGGDGGDGASLAGLGLDFGGTPDFGEENPPKEAEEAEEIPEVDTPLDEA*
Ga0182001_1040599313300014488SoilAALEEIGSDGGDGLDLASLGLDFGGQPEQNDEGKPKESTEAEEVPEVDSPLDES*
Ga0182008_1089432313300014497RhizosphereEEIGADGDAAIDFAALGIDFGGEPETTDEPKPKRASTEAEEIPEVDSPLDEG*
Ga0132258_1368915713300015371Arabidopsis RhizosphereVPKETYEREALLAALQEIGSDGGDGIDLDSLGLDFGGGPAPTDGDPKPHESTEAEEVPEVDTPLDGE*
Ga0132256_10332780913300015372Arabidopsis RhizosphereKVPKETYEREALLAALQEIDSDGSDGIDLASLGLDFGGEPTENDQAKPQESTEAEEVPEVDSPLDGE*
Ga0134069_101752133300017654Grasslands SoilLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES
Ga0187785_1059523123300017947Tropical PeatlandGADGGDGLNLAGLGLDFGGEPQGGDGESKPRESTEAEEVPEVDSPLDE
Ga0184608_1002531533300018028Groundwater SedimentLAALEEIGSDGGEGIDLASLGLDFGGEPETDGESKPRESTEAEEVPEVDTPLDE
Ga0187773_1094030423300018064Tropical PeatlandGVEGLDLASLGLDFSEGNGETDGEGKRPTTEAEEVPEVDTPLDE
Ga0066655_1124087613300018431Grasslands SoilPSEKVPAETYEREALLAALQEIGGDGGDGASLAGLGLDFGGTPDFGEENPPKEEVEAEEIPEVDTPLDES
Ga0190270_1052357213300018469SoilLAALEEIGTDGGDGMSLKDLGIDFGGAPEVNGGDGAPKASTEAEEVPEVDSGDAS
Ga0066669_1090773413300018482Grasslands SoilALLAALQEIGGNGGDAAGLASLGLDFGGTPDYGEENPPKEDGEAEEIPEVDTPLDEG
Ga0180110_108875013300019208Groundwater SedimentLAALEEIGSDGGDGMSLKDLGIDFGGAPEVNGGDGAPKASTEAEEVPEVDSPLDEK
Ga0193715_102137123300019878SoilETYEREALLAALEEIGSDGGEGIDLASLGLDFGAEPETDGESKPRESTEAEEVPEVDTPLDE
Ga0196963_1032716423300020215SoilDGFDLKSLGIDFGGAPDFGGENPPLEAGEAEEIPEIDSPLDNES
Ga0193695_109983823300021418SoilEREALLAALQEIDSDGGEGSIDLAGLGIDFGGTPDFGEENPPKEAGEAEEVPEVDTPLDE
Ga0222623_1014050613300022694Groundwater SedimentEALLAALQEIDSDGGEGVDLASLGFDFGGEPKTDGESTPRESTEAEEVPEVDTPLDGE
Ga0222623_1025174333300022694Groundwater SedimentDGGDGIDLASLGLDFGGEPQTTDGEQPPPRESTEAEEVPEVDSPLDEK
Ga0207685_1080305723300025905Corn, Switchgrass And Miscanthus RhizosphereEAELLAALEEIGTDGGNGLDLGSLGLDFGGQPGADSISSHEAGEAEEIPEVDTPLDD
Ga0207664_1065073923300025929Agricultural SoilGDGGDGASLASLGLDFGGTPDFGEENPPSEEVEAEEIPEVDTPLDES
Ga0207665_1087456123300025939Corn, Switchgrass And Miscanthus RhizosphereLQEIGGDGGDGASLASLGLDFGGTPDFGEENPPSEEVEAEEIPEVDTPLDES
Ga0207708_1097602013300026075Corn, Switchgrass And Miscanthus RhizosphereVPKEAYERETLLAALQEIGSDGGGMDLGSLGLDFGGQPDLNDEAKPREATEAEEIPED
Ga0207683_1142380323300026121Miscanthus RhizosphereLQEIGSDGGEGIDLASLGLDFGGGPEPTDGDPKPHESTEAEEVPEVDTPLDGE
Ga0209577_1010892933300026552SoilAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPKEEGEAEEIPEVDTPLDE
Ga0208890_105837513300027523SoilALEEIGSDGGEGLDLASLGLDFGDGGETDGEAKRPSTEADEVPEVDTPLDE
Ga0307285_1018817213300028712SoilTDGGEGVDLASLGLDFGGAPEPAAPENGGNAKPRESTEAEEVPEVDTPLYGE
Ga0307298_1001280913300028717SoilIGSDGGEGIDLASLGLDFGGEPETNGEGAPPRESTEAEEVPEVDTPLDE
Ga0307307_1001251533300028718SoilLLAALQEIGSDGGDGIDLASLGLDFGGGPEPTDGDPKAHESTEAEEVPEVDTPLDGE
Ga0307301_1017581213300028719SoilEEIGSDGGEGIDLASLGLDFGGEPETNGEGAPPRESTEAEEVPEVDTPLDE
Ga0307317_1008290613300028720SoilLAALQEIGSDGGDGIDLASLGLDFGGQPETTDGEQPPARESTEAEEVPEVDTPLDGE
Ga0307315_1013961023300028721SoilALQEIGSDGGEGIDLASLGLDFGGGPEPTDGDSKPRESTEAEEVPEVDTPLDGE
Ga0307319_1029071623300028722SoilSEKVPAETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPKEEIEAEEVPEVDTPLDES
Ga0307320_1021169723300028771SoilDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDES
Ga0307282_1002314613300028784SoilPSEKVPKETYEREALLAALQEIDSDGGEGVDLASLGFDFGGEPKTDGESTPRESTEAEEVPEVDTPLDGE
Ga0307282_1004060623300028784SoilEIGSDGGDGIDLASLGLDFGGGPEPTDGDPKAHESTEAEEVPEVDTPLDGE
Ga0307282_1031606723300028784SoilDGGDGIDLASLGLDFGGEPQTTDGEQPPPRESTEAEEVPEVDSPLDGE
Ga0307287_1012957313300028796SoilAALEEIGSDGGDGIDLASLGLDFGGEPQTTDGEQPPPRESTEAEEVPEVDTPLDGE
Ga0307284_1009594623300028799SoilSDGGEGIDLASLGLDFGGEPETNGEGAPPRESTEAEEVPEVDTPLDE
Ga0307305_1027477113300028807SoilREALLAALEEIGSDGGEGIDLASLGLDFGGEPETNGEGAPPRESTEAEEVPEVDTPLDE
Ga0307286_1035314613300028876SoilDGGEGVDLASLGLDFGGAPEPAAPENGGNAKPRESTEAEEVPEVDTPLDGE
Ga0310813_1045181623300031716SoilQEIGTDGGDGIDLASLALDFGGGPAPTDGDPKPHESTEAEEVPEVDTPLDGE
Ga0307469_1008512013300031720Hardwood Forest SoilYEREALLAALQEIGGDGGDGASLASLGLDFGGTPEFGEENPPSEEVEAEEIPEVDTPLDE
Ga0310900_1103422413300031908SoilEALLAALQEIGSDGGEGIDLASLGLDFGGGPEPTDGDPKPHESTEAEEVPEVDTPLDGE
Ga0310895_1008198023300032122SoilSEKVPAETYEREALLAALQEIGGDGGDGASLASLGLDFGGTPDFGEENPPSEEVEAEEIPEVDTPLDES
Ga0307471_10411138423300032180Hardwood Forest SoilSDGGEGIDLASLGLDFGGGPEPTDGDPKPHESTEAEEVPEVDTPLDGE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.