Basic Information | |
---|---|
Family ID | F079847 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 40 residues |
Representative Sequence | PLPSARIGTAAMIEDYEFLRSNGSPDFLSALQKEWKATN |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.74 % |
% of genes near scaffold ends (potentially truncated) | 96.52 % |
% of genes from short scaffolds (< 2000 bps) | 86.96 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.348 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.913 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.217 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.870 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF01578 | Cytochrom_C_asm | 26.09 |
PF00535 | Glycos_transf_2 | 13.91 |
PF01797 | Y1_Tnp | 6.96 |
PF03379 | CcmB | 2.61 |
PF00719 | Pyrophosphatase | 1.74 |
PF13683 | rve_3 | 0.87 |
PF12833 | HTH_18 | 0.87 |
PF03100 | CcmE | 0.87 |
PF00069 | Pkinase | 0.87 |
PF00115 | COX1 | 0.87 |
PF13276 | HTH_21 | 0.87 |
PF08327 | AHSA1 | 0.87 |
PF08388 | GIIM | 0.87 |
PF03551 | PadR | 0.87 |
PF00158 | Sigma54_activat | 0.87 |
PF13620 | CarboxypepD_reg | 0.87 |
PF02635 | DrsE | 0.87 |
PF01964 | ThiC_Rad_SAM | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 6.96 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.48 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 2.61 |
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 1.74 |
COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.87 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.87 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.87 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.87 |
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.35 % |
Unclassified | root | N/A | 15.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004091|Ga0062387_101483090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300004152|Ga0062386_101253346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300004633|Ga0066395_11035917 | Not Available | 502 | Open in IMG/M |
3300004635|Ga0062388_101021106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300005439|Ga0070711_100042309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3079 | Open in IMG/M |
3300005439|Ga0070711_100740563 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300005526|Ga0073909_10018595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2231 | Open in IMG/M |
3300005602|Ga0070762_10164813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
3300005610|Ga0070763_10854087 | Not Available | 540 | Open in IMG/M |
3300005712|Ga0070764_10051102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2121 | Open in IMG/M |
3300005764|Ga0066903_106460493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300006046|Ga0066652_101138260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300006050|Ga0075028_100108383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1426 | Open in IMG/M |
3300006797|Ga0066659_10220877 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300009525|Ga0116220_10042396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1888 | Open in IMG/M |
3300009624|Ga0116105_1152333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300009628|Ga0116125_1075598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300009641|Ga0116120_1059943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
3300009665|Ga0116135_1508494 | Not Available | 500 | Open in IMG/M |
3300009839|Ga0116223_10340834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
3300010359|Ga0126376_12600258 | Not Available | 555 | Open in IMG/M |
3300010366|Ga0126379_12252282 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300010379|Ga0136449_100944652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
3300010379|Ga0136449_100998787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
3300010379|Ga0136449_101234507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
3300010379|Ga0136449_102722274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300011120|Ga0150983_12075669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300011120|Ga0150983_13427536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300012202|Ga0137363_11060865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300012582|Ga0137358_10603561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300012925|Ga0137419_11616659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300014501|Ga0182024_12782664 | Not Available | 521 | Open in IMG/M |
3300014657|Ga0181522_10449879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300014657|Ga0181522_10533276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300015242|Ga0137412_10539123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300016371|Ga0182034_11300381 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300017822|Ga0187802_10261661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300017924|Ga0187820_1019384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1702 | Open in IMG/M |
3300017946|Ga0187879_10003838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10084 | Open in IMG/M |
3300017970|Ga0187783_10099723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
3300017975|Ga0187782_10006540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8666 | Open in IMG/M |
3300017975|Ga0187782_10259243 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300018018|Ga0187886_1183595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300018023|Ga0187889_10255383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300018037|Ga0187883_10403507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300018085|Ga0187772_11308191 | Not Available | 536 | Open in IMG/M |
3300018090|Ga0187770_11315291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300018090|Ga0187770_11484804 | Not Available | 552 | Open in IMG/M |
3300018431|Ga0066655_11390084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300018468|Ga0066662_12765779 | Not Available | 520 | Open in IMG/M |
3300020021|Ga0193726_1104844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
3300020583|Ga0210401_11526183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300021046|Ga0215015_10129859 | Not Available | 712 | Open in IMG/M |
3300021171|Ga0210405_10946015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300021171|Ga0210405_11203168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300021181|Ga0210388_10789971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300021401|Ga0210393_10222674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1528 | Open in IMG/M |
3300021402|Ga0210385_11074670 | Not Available | 618 | Open in IMG/M |
3300021407|Ga0210383_11757052 | Not Available | 507 | Open in IMG/M |
3300021420|Ga0210394_10109940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2385 | Open in IMG/M |
3300021432|Ga0210384_10387738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300021433|Ga0210391_10768992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300021474|Ga0210390_10137706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2052 | Open in IMG/M |
3300021475|Ga0210392_10637644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300021476|Ga0187846_10100156 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300021559|Ga0210409_11538200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300022557|Ga0212123_10271602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
3300023056|Ga0233357_1022672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300023255|Ga0224547_1033301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300024225|Ga0224572_1012109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1636 | Open in IMG/M |
3300025434|Ga0208690_1043035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300025912|Ga0207707_10332254 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300025916|Ga0207663_11629033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300026941|Ga0207741_1026874 | Not Available | 605 | Open in IMG/M |
3300027537|Ga0209419_1071960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300027587|Ga0209220_1008384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2759 | Open in IMG/M |
3300027591|Ga0209733_1000248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9214 | Open in IMG/M |
3300027591|Ga0209733_1168396 | Not Available | 524 | Open in IMG/M |
3300027660|Ga0209736_1040710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1349 | Open in IMG/M |
3300027676|Ga0209333_1186596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300027684|Ga0209626_1106803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300027745|Ga0209908_10017421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1318 | Open in IMG/M |
3300027825|Ga0209039_10411415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300027857|Ga0209166_10016431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4673 | Open in IMG/M |
3300027857|Ga0209166_10207234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300027879|Ga0209169_10173417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
3300027986|Ga0209168_10234428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
3300028780|Ga0302225_10042914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2250 | Open in IMG/M |
3300028906|Ga0308309_11279747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300028906|Ga0308309_11669229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300029914|Ga0311359_10342808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1210 | Open in IMG/M |
3300029999|Ga0311339_11025478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300030494|Ga0310037_10189066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 918 | Open in IMG/M |
3300030509|Ga0302183_10221485 | Not Available | 737 | Open in IMG/M |
3300030659|Ga0316363_10262626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300030687|Ga0302309_10519228 | Not Available | 566 | Open in IMG/M |
3300030738|Ga0265462_10234119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
3300030991|Ga0073994_12036756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300031231|Ga0170824_106878591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
3300031231|Ga0170824_110222344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300031446|Ga0170820_11866647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300031474|Ga0170818_105874576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300031715|Ga0307476_10010216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5841 | Open in IMG/M |
3300031715|Ga0307476_10852938 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300031726|Ga0302321_100254754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1860 | Open in IMG/M |
3300031753|Ga0307477_10350493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300031754|Ga0307475_11038929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300031823|Ga0307478_10021783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4533 | Open in IMG/M |
3300031823|Ga0307478_10744119 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300031823|Ga0307478_11383268 | Not Available | 584 | Open in IMG/M |
3300031954|Ga0306926_12224682 | Not Available | 610 | Open in IMG/M |
3300032001|Ga0306922_12413168 | Not Available | 502 | Open in IMG/M |
3300032770|Ga0335085_10561044 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300033134|Ga0335073_10074938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4437 | Open in IMG/M |
3300034163|Ga0370515_0150822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.91% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.09% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.22% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.22% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.35% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.48% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.48% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.48% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.87% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.87% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.87% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.87% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.87% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.87% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.87% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026941 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 39 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062387_1014830903 | 3300004091 | Bog Forest Soil | RVIRSESPLPSARVGTAAMIEDYEFLRSGTTADFLSSLQKNWKAAN* |
Ga0062386_1012533462 | 3300004152 | Bog Forest Soil | RVESPLPSQRIGTAAMIEDYEFLRSSASSDFLSALQKEWKAAN* |
Ga0066395_110359171 | 3300004633 | Tropical Forest Soil | EAPLPSARIGVAAMIEDYQFLRSASGSPDFLTALQNEWKNTH* |
Ga0062388_1010211063 | 3300004635 | Bog Forest Soil | ESPLPSSRVGTAAMIEDYEFLRSNGNGDLFSALQHEVEN* |
Ga0070711_1000423096 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LPSARIGVAAMIEGYEFLRSSSTPDFLSALQNELKSNTTN* |
Ga0070711_1007405631 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NPLPSARVGVAAMIEDYEFLRSGGSSDFLSALQRRMDNQ* |
Ga0073909_100185951 | 3300005526 | Surface Soil | RVIRVEHPLPSARVGTAAMIEDYEFLRSNGSPDFLSALQKEWKASN* |
Ga0070762_101648134 | 3300005602 | Soil | SARIGTAAMIEDYEFLRSNGSPDFLAALQSEWKASN* |
Ga0070763_108540871 | 3300005610 | Soil | LRIGTAAMIEDYEFLRSGGSPDFFSAIQDEYKATN* |
Ga0070764_100511025 | 3300005712 | Soil | RIGTAAMIEDYEFLRSSGSADFLSALQREMKTPN* |
Ga0066903_1064604933 | 3300005764 | Tropical Forest Soil | VENPLPSLRIGTAAMIEDYEFLRSNGSPDFLAALQREWKASN* |
Ga0066652_1011382603 | 3300006046 | Soil | SPSLRVGTAAMIENYEFLRSGGGPDFLSVLQTDWKAS* |
Ga0075028_1001083834 | 3300006050 | Watersheds | RIGTAAMIENYEFLRSGGSPDFLSALQKEWKTAN* |
Ga0066659_102208771 | 3300006797 | Soil | RVESPLPSLRIGTAAMIENYEFLRSNGTADFLSALQKEWKTAN* |
Ga0116220_100423963 | 3300009525 | Peatlands Soil | ARVGTAAMIEDYEFLRSNGSPDLLTALQKEWKATN* |
Ga0116105_11523333 | 3300009624 | Peatland | RVDSPLPSLRIGTAAMIEDYEFLRSSGSTDFLSALQRGMTN* |
Ga0116125_10755983 | 3300009628 | Peatland | SESPLPSLRVGTAAMIEDYEFLRSGGSADFLSALQKEWKAAN* |
Ga0116120_10599431 | 3300009641 | Peatland | SLRVGTAAMIEDYEFLRSADSADFLTALQEEWKAAN* |
Ga0116135_15084943 | 3300009665 | Peatland | RSESPLPSSRVGTAAMIEDYEFLRSTGSTDFFSALQKDWKATN* |
Ga0116223_103408341 | 3300009839 | Peatlands Soil | IRVESPLPSQRIGTAAMIEEYEFLRSNGNPDLFNALQREWKAAN* |
Ga0126376_126002581 | 3300010359 | Tropical Forest Soil | PLPSARIGVAAMIEDYQFLRSASGSPDFLTALQNEWKNTH* |
Ga0126379_122522822 | 3300010366 | Tropical Forest Soil | PSARIGVAAMIEDYQFLRSASGSPDFLTALQNEWKNTH* |
Ga0136449_1009446523 | 3300010379 | Peatlands Soil | LPSARIGTAAMIEDYEFLRSNGSPDFLAALQSEWKSSN* |
Ga0136449_1009987871 | 3300010379 | Peatlands Soil | PSARIGTAAMIEDYEFLRSNGSPDFLAALQSEWKSSN* |
Ga0136449_1012345073 | 3300010379 | Peatlands Soil | RIGTAAMIEDYEFLRSNGSPDFLAALQSEWKASN* |
Ga0136449_1027222741 | 3300010379 | Peatlands Soil | SPLPSSRVGTAAMIEDYEFLRSSGSTSFLSALQREWKETN* |
Ga0150983_120756692 | 3300011120 | Forest Soil | LPSLRVGTAAMIEDYEFLRSAGSTDFLSALQRQIKSPN* |
Ga0150983_134275361 | 3300011120 | Forest Soil | VESPLPSLRIGTAAMIEDYEFLRSGGSTELLSALQREFKAPN* |
Ga0137363_110608651 | 3300012202 | Vadose Zone Soil | RVESPSPSLRVGTAAMIEDYEFLRSGGGPDFLSVLQTDWKAS* |
Ga0137358_106035613 | 3300012582 | Vadose Zone Soil | VIRVESPLPSLRIGTAAMIEDYEFLRSTGSSDFLSALSREAAN* |
Ga0137419_116166591 | 3300012925 | Vadose Zone Soil | RVESPLPSLRIGTAAMIENYEFLRSGGGGDFLSALQQEWKAAN* |
Ga0182024_127826641 | 3300014501 | Permafrost | PLPSSRIGIAALIEDYQFLRSNGSPDLLSALQKEWKATN* |
Ga0181522_104498793 | 3300014657 | Bog | RIGTAAMIEDYEFLRSNGSPDFLSALQSEWKQSN* |
Ga0181522_105332761 | 3300014657 | Bog | RVENALPSARVGTAAMIEDYEFLRSNGSPDFLAALQKEWKATN* |
Ga0137412_105391231 | 3300015242 | Vadose Zone Soil | VESPLPSLRIGTAALIEDYEFLRSTGSSDFLSALSREAAN* |
Ga0182034_113003812 | 3300016371 | Soil | PSARVGIAAVIENYEFLRSDAGPDLLAALQAEFKNTN |
Ga0187802_102616611 | 3300017822 | Freshwater Sediment | ARIGTAAMIEDYEFLRSNGSPDFLAALQSEWKSSN |
Ga0187820_10193841 | 3300017924 | Freshwater Sediment | HPLPSLRIGTAAMIENYEFLRSDGSPDFLGALQEWKGSN |
Ga0187879_100038381 | 3300017946 | Peatland | LPSLRVGTAAMIEDYEFLRSADSADFLTALQEEWKAAN |
Ga0187783_100997235 | 3300017970 | Tropical Peatland | VIRVENPLPSARIGVAAMIEDYEFLRSSGGSDLLSVLQKEWKKTS |
Ga0187782_100065401 | 3300017975 | Tropical Peatland | STRVGTAAMIEEYEFLRSNGSPDFFSALQKEWKANN |
Ga0187782_102592431 | 3300017975 | Tropical Peatland | PSTRIGVAAMIEDYEFLRSSGGADLLSALQTGWKKTS |
Ga0187886_11835951 | 3300018018 | Peatland | ARVIRSESPLPSLRVGTAAMIEDYEFLRSGGSADFLSALQKEWKAAN |
Ga0187889_102553831 | 3300018023 | Peatland | PLPSMRIGTAATIEEYEFLRSNGNPDFFSALQQEWKAAN |
Ga0187883_104035071 | 3300018037 | Peatland | SSRVGTAAMIEDYEFLRSTGSTDFFSALQKDWKATN |
Ga0187772_113081912 | 3300018085 | Tropical Peatland | SARVGTAAMIESYEFLRSNGSPDLMSALQKEWKATN |
Ga0187770_113152911 | 3300018090 | Tropical Peatland | RVESPLPSSRVGTAAMIEDYEFLRSNGSPDFFSALQKEWKANN |
Ga0187770_114848041 | 3300018090 | Tropical Peatland | PSFRIGTAAMIENYEFLRPEDSADFVSTLQKEWKAAQ |
Ga0066655_113900843 | 3300018431 | Grasslands Soil | PSARIGTAAMIEDYEFLRSNGSPDFLSALQSEWKASN |
Ga0066662_127657791 | 3300018468 | Grasslands Soil | VIRVDQPLPSARVGTAAMIEDYEFLRSNGSPDFLSALQKEWKATN |
Ga0193726_11048443 | 3300020021 | Soil | PLPSLRIGTAAMIENYEFLRSSGTMDFFSAAMQSKAGD |
Ga0210401_115261831 | 3300020583 | Soil | LPSLRVGTAAMIEDYEFLRSSGSTDFLSALQREAKVPN |
Ga0215015_101298591 | 3300021046 | Soil | IRVESPSPSLRVGTAAMIEDYEFLRSGGGTDFLSALQTDWKAL |
Ga0210405_109460151 | 3300021171 | Soil | HPLPSARIGTAAMIEDYEFLRSNGSPDFLTALQSEWKASN |
Ga0210405_112031683 | 3300021171 | Soil | ESPLPSSRVGTAAMIEDYEFLRSTGSTDFLSALQREMKVPN |
Ga0210388_107899712 | 3300021181 | Soil | RSEAPLPSARIGTAAMIEDYEFLRSSGSSDFLSALQRDWKATN |
Ga0210393_102226744 | 3300021401 | Soil | RVIRSESPLPSLRVGTAAMIEDYEFLRSGGNTDFLGALQKEWKAAN |
Ga0210385_110746701 | 3300021402 | Soil | SPLPSLRIGTAAMIEDYEFLRSGGSPDFFSAIQNEYKATN |
Ga0210383_117570521 | 3300021407 | Soil | VIRVEHPLPSARIGTAAMIEDYEFLRSNGSPDFLSALQKEWKASN |
Ga0210394_101099405 | 3300021420 | Soil | VESPLPSMRIGTAAMIEDYEFLRSTGSSDFLSVLSRETAN |
Ga0210384_103877383 | 3300021432 | Soil | SLRIGTAAMIEDYEFLRSGGSPDFLSALQKEWKATN |
Ga0210391_107689921 | 3300021433 | Soil | HPMPSARIGTAAMIEDYEFLRSNGSPDFLAALQSEWKASN |
Ga0210390_101377064 | 3300021474 | Soil | SARIGTAAMIEDYEFLRSNGSPDFLAALQSEWKSTN |
Ga0210392_106376443 | 3300021475 | Soil | PLPSARVGTAAMIEDYEFLRSTGAPDFLAALQSEWKSSN |
Ga0187846_101001561 | 3300021476 | Biofilm | PSSRIGVAAMIEDYEFLRSNGSPDFFSALQKEWKETN |
Ga0210409_115382002 | 3300021559 | Soil | SPLPSLRIGTAAMIEDYEFLRSSGNADFLSALQKEWKAAN |
Ga0212123_102716021 | 3300022557 | Iron-Sulfur Acid Spring | SSRIGIAALIENYQFLRSNGSPDFLSALQKEWKAAN |
Ga0233357_10226723 | 3300023056 | Soil | LPSARIGTAAIIEDYQFLRSNDAPDLLSALPKEWKGSN |
Ga0224547_10333011 | 3300023255 | Soil | VIRSESPLPSSRVGTAAMIEDYEFLRSSGSADFLSALQKEWKAAN |
Ga0224572_10121093 | 3300024225 | Rhizosphere | VESPLPSLRIGTAAMIEDYEFLRSGGGNDFLSALQKEWKAAN |
Ga0208690_10430353 | 3300025434 | Peatland | LPSLRVGTAAMIEDYEFLRSGGSADFLSALQKEWKAAN |
Ga0207707_103322541 | 3300025912 | Corn Rhizosphere | IRVEGPLPSARIGVAALIEDYEFVRSNGTTDFQSVLQRESQSPN |
Ga0207663_116290332 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRVENPLPSARVGVAAMIEDYEFLRSGGSSDFLSALQRRMDNQ |
Ga0207741_10268742 | 3300026941 | Tropical Forest Soil | RVENPLPSSRVGTAAMIEDYEFLRSSGSPDFLAALQGEWKSTH |
Ga0209419_10719603 | 3300027537 | Forest Soil | PLPSARIGTAAMIEDYEFLRSNGSPDFLSALQKEWKATN |
Ga0209220_10083845 | 3300027587 | Forest Soil | MKRLLLGTAAMIEDYEFLRSGGGTDFLRALQTDWKAL |
Ga0209733_10002481 | 3300027591 | Forest Soil | IRVEHPLPSARIGTAAMIEDYEFLRSNGSPDFLSALQKEWKATN |
Ga0209733_11683961 | 3300027591 | Forest Soil | PLPSARIGTAAMIEDYEFLRSNGAPDFLSALQKEWKATN |
Ga0209736_10407103 | 3300027660 | Forest Soil | RVENPLPSARIGTAATIEDYQFLRSNGAPDLLSALQKEWKGSN |
Ga0209333_11865961 | 3300027676 | Forest Soil | IRVESPLPSLRIGTAAMIEDYEFLRTSGSADFLSALQREMKTPN |
Ga0209626_11068033 | 3300027684 | Forest Soil | SESPLPSLRVGTAAMIEDYEFLRSTGSTDFISALQKDWKAAN |
Ga0209908_100174211 | 3300027745 | Thawing Permafrost | IRSESPLPSSRVGTAAMIEDYEFLRSTGSTDFFSALQKDWKATN |
Ga0209039_104114152 | 3300027825 | Bog Forest Soil | QPLPSARIGTAAMIEDYEFLRSNGNPDFLAALQSQWKSTN |
Ga0209166_100164311 | 3300027857 | Surface Soil | ESPLPSLRIGTAALIEDYEFLRSNGSPDFLSALQKEWKATN |
Ga0209166_102072343 | 3300027857 | Surface Soil | SSRVGTAAMIEDYEFLRSGDSDFFGALQKEWKTAQ |
Ga0209169_101734171 | 3300027879 | Soil | SARIGTAAMIEDYEFLRSNGSPDFLTALQSEWKASN |
Ga0209168_102344283 | 3300027986 | Surface Soil | SRIGTAAMIENYEFLRSSGGADFLSALQPGSKEPN |
Ga0302225_100429145 | 3300028780 | Palsa | LRIGTAATIEDYEFLRSAGSADLLSALQQEWKATN |
Ga0308309_112797471 | 3300028906 | Soil | SPLPSLRVGTAAMIEDYEFLRSTGSTDFISALQKDWKAAN |
Ga0308309_116692291 | 3300028906 | Soil | PLPSLRIGTAAMIEDYEFLRSGGSTELLSALQREFKAPN |
Ga0311359_103428084 | 3300029914 | Bog | LPSLRIGTAAMIEDYEFLRSSGSTDFLSALQRGMTN |
Ga0311339_110254783 | 3300029999 | Palsa | SSRIGTAAIIEDYEFLRSNGSPDLLNALQKEWKAAN |
Ga0310037_101890663 | 3300030494 | Peatlands Soil | LPSARVGTAAMIEDYEFLRSNGSPDLLTALQKEWKATN |
Ga0302183_102214852 | 3300030509 | Palsa | RVEHPLPSARIGTAAMIEDYEFLRSGGSPDFFSALQSEWKASN |
Ga0316363_102626263 | 3300030659 | Peatlands Soil | IRVESPLPSQRIGTAAMIEEYEFLRSNGNPDLFNALQREWKAAN |
Ga0302309_105192281 | 3300030687 | Palsa | VIRVEHPLPSARIGTAAMIEDYEFLRSGGSPDFFSALQSEWKASN |
Ga0265462_102341193 | 3300030738 | Soil | SARIGTAAMIEDYEFLRSGGSPDFLSALQSEWKSSN |
Ga0073994_120367561 | 3300030991 | Soil | SRIGTAALIEDYQFLRSNGAPDFLSALQREWKASN |
Ga0170824_1068785913 | 3300031231 | Forest Soil | VDHPLPSARVGTAALIENYEFLRSTGGADFLSSLQELKAAN |
Ga0170824_1102223442 | 3300031231 | Forest Soil | VIRVEHPFPSARIGTAAMIEDYEVLRSNGTPDFLSALQSEWKSSN |
Ga0170820_118666473 | 3300031446 | Forest Soil | PLPSLRVGTAATIEEYEFLRSAGSADLFSALQQEWKAAN |
Ga0170818_1058745762 | 3300031474 | Forest Soil | IPISPSARIGTAAMIEDYEFLRSSGTPDFLSALQSEWKSSN |
Ga0307476_100102168 | 3300031715 | Hardwood Forest Soil | HRIGTAAMIEDYEFLRSGASTDFLSALQREMNEPN |
Ga0307476_108529382 | 3300031715 | Hardwood Forest Soil | SARIGVAAMIEDYEFLRSNGAPDFLAALQDEWKSAN |
Ga0302321_1002547542 | 3300031726 | Fen | SRVGVAALIEDYEFLRSSPTPDFLASLQKDWSGSN |
Ga0307477_103504933 | 3300031753 | Hardwood Forest Soil | SPLPSLRVGTAAMIEDYEFLRSSGSTDFLSALQREMKVPS |
Ga0307475_110389293 | 3300031754 | Hardwood Forest Soil | VIRVESPLPSQLIGTAAMIEDYEFLRSSASSDFLSALQKEWKEAN |
Ga0307478_100217831 | 3300031823 | Hardwood Forest Soil | SPLPSSRVGTAAMIENYEFLRSTGSTDFLSALQRDWKAAN |
Ga0307478_107441192 | 3300031823 | Hardwood Forest Soil | VESPLPSARIGVAAMIEDYEFLRTTGSTDFLSALQTGLKSAN |
Ga0307478_113832682 | 3300031823 | Hardwood Forest Soil | SARIGTAAMIEDYEFLRSNGAPDFLSALQKEWKASN |
Ga0306926_122246822 | 3300031954 | Soil | RVDDPLPSARIGVAAMIEDYEFLRSTGTPDLLTALDNEWKKTH |
Ga0306922_124131682 | 3300032001 | Soil | PSARIGVAAMIEDYEFLRSTGTPDLLTALDNEWKKTH |
Ga0335085_105610444 | 3300032770 | Soil | ARVIRVEDPLPSARVGVAAMIEDYEFLRSGGSDFLSALQKGMQGH |
Ga0335073_100749381 | 3300033134 | Soil | VENPLPSARVGVAAMIENYEFLRSNGSPDLLSALQKEWKSAN |
Ga0370515_0150822_785_895 | 3300034163 | Untreated Peat Soil | LPSQRIGTAAMIEDYEFLRSGGSPDFFSALQREAEN |
⦗Top⦘ |