Basic Information | |
---|---|
Family ID | F079687 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 115 |
Average Sequence Length | 42 residues |
Representative Sequence | ALARLVAARAREVALATLSGKTTVEVAIVDREGEFLARVGG |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 115 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.13 % |
% of genes from short scaffolds (< 2000 bps) | 92.17 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.69 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.304 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.043 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.348 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.957 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 13.04% Coil/Unstructured: 63.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 115 Family Scaffolds |
---|---|---|
PF02571 | CbiJ | 76.52 |
PF12796 | Ank_2 | 6.96 |
PF00590 | TP_methylase | 3.48 |
PF13637 | Ank_4 | 3.48 |
PF13857 | Ank_5 | 2.61 |
PF13606 | Ank_3 | 0.87 |
PF13340 | DUF4096 | 0.87 |
PF00583 | Acetyltransf_1 | 0.87 |
PF13533 | Biotin_lipoyl_2 | 0.87 |
PF00491 | Arginase | 0.87 |
PF00528 | BPD_transp_1 | 0.87 |
COG ID | Name | Functional Category | % Frequency in 115 Family Scaffolds |
---|---|---|---|
COG2099 | Precorrin-6x reductase | Coenzyme transport and metabolism [H] | 76.52 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.87 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.30 % |
Unclassified | root | N/A | 8.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004081|Ga0063454_101429575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 587 | Open in IMG/M |
3300005187|Ga0066675_10832065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 698 | Open in IMG/M |
3300005367|Ga0070667_101597795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 613 | Open in IMG/M |
3300005445|Ga0070708_100726577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 934 | Open in IMG/M |
3300005555|Ga0066692_10774583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 591 | Open in IMG/M |
3300005587|Ga0066654_10919715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300005618|Ga0068864_101027696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 818 | Open in IMG/M |
3300005764|Ga0066903_101333245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1343 | Open in IMG/M |
3300005764|Ga0066903_102402945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1019 | Open in IMG/M |
3300006893|Ga0073928_10689885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 713 | Open in IMG/M |
3300006914|Ga0075436_101319042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 546 | Open in IMG/M |
3300006954|Ga0079219_12028983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 548 | Open in IMG/M |
3300007004|Ga0079218_11550515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 721 | Open in IMG/M |
3300007076|Ga0075435_100856380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 792 | Open in IMG/M |
3300007258|Ga0099793_10665476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300010048|Ga0126373_10156089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2174 | Open in IMG/M |
3300010048|Ga0126373_10568165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
3300010048|Ga0126373_10758898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1031 | Open in IMG/M |
3300010337|Ga0134062_10331298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
3300010376|Ga0126381_102470911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
3300010376|Ga0126381_105094810 | Not Available | 503 | Open in IMG/M |
3300010397|Ga0134124_12210976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
3300010398|Ga0126383_12720171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
3300010880|Ga0126350_10530347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1068 | Open in IMG/M |
3300012208|Ga0137376_11001301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
3300012961|Ga0164302_11544330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300013296|Ga0157374_12705209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
3300016270|Ga0182036_10438858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
3300016270|Ga0182036_11922876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300016294|Ga0182041_10097286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2151 | Open in IMG/M |
3300016341|Ga0182035_11125408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 699 | Open in IMG/M |
3300016371|Ga0182034_10258938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1376 | Open in IMG/M |
3300016404|Ga0182037_10894366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
3300016404|Ga0182037_10952092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
3300016422|Ga0182039_10972611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300016445|Ga0182038_10193792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1593 | Open in IMG/M |
3300017955|Ga0187817_10600405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
3300018001|Ga0187815_10420042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 570 | Open in IMG/M |
3300018431|Ga0066655_10192922 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300018431|Ga0066655_10263836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1107 | Open in IMG/M |
3300021171|Ga0210405_10161812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1773 | Open in IMG/M |
3300021420|Ga0210394_10319675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1363 | Open in IMG/M |
3300021478|Ga0210402_11530740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
3300021560|Ga0126371_11633160 | Not Available | 770 | Open in IMG/M |
3300022532|Ga0242655_10255135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300022840|Ga0224549_1016961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1021 | Open in IMG/M |
3300025898|Ga0207692_10464742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Neorhizobium → unclassified Neorhizobium → Neorhizobium sp. NCHU2750 | 798 | Open in IMG/M |
3300025916|Ga0207663_10275229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
3300026095|Ga0207676_10982327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 831 | Open in IMG/M |
3300026308|Ga0209265_1212148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
3300026343|Ga0209159_1170579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
3300026475|Ga0257147_1051183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300027669|Ga0208981_1032616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1331 | Open in IMG/M |
3300027773|Ga0209810_1201139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
3300027867|Ga0209167_10543478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300027875|Ga0209283_10955863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300027905|Ga0209415_10153663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2305 | Open in IMG/M |
3300027905|Ga0209415_10534344 | Not Available | 891 | Open in IMG/M |
3300027905|Ga0209415_10534345 | Not Available | 891 | Open in IMG/M |
3300028807|Ga0307305_10396468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300030730|Ga0307482_1289640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300031027|Ga0302308_10638700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300031231|Ga0170824_100776772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
3300031234|Ga0302325_12212036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
3300031525|Ga0302326_13432189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
3300031564|Ga0318573_10051578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2010 | Open in IMG/M |
3300031572|Ga0318515_10526625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
3300031573|Ga0310915_10192097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1425 | Open in IMG/M |
3300031640|Ga0318555_10130264 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300031679|Ga0318561_10048106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2124 | Open in IMG/M |
3300031679|Ga0318561_10094812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1561 | Open in IMG/M |
3300031681|Ga0318572_10831386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300031681|Ga0318572_10867141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300031682|Ga0318560_10703455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
3300031715|Ga0307476_10945407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
3300031719|Ga0306917_10221895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1439 | Open in IMG/M |
3300031736|Ga0318501_10560054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
3300031753|Ga0307477_10851191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300031754|Ga0307475_10383872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1129 | Open in IMG/M |
3300031764|Ga0318535_10013430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2995 | Open in IMG/M |
3300031768|Ga0318509_10129604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1381 | Open in IMG/M |
3300031771|Ga0318546_10323797 | Not Available | 1069 | Open in IMG/M |
3300031792|Ga0318529_10588555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300031793|Ga0318548_10171147 | Not Available | 1062 | Open in IMG/M |
3300031794|Ga0318503_10227922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300031819|Ga0318568_10586070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
3300031846|Ga0318512_10068195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1621 | Open in IMG/M |
3300031879|Ga0306919_10075467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2309 | Open in IMG/M |
3300031879|Ga0306919_10682244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300031880|Ga0318544_10169225 | Not Available | 841 | Open in IMG/M |
3300031890|Ga0306925_10486084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1316 | Open in IMG/M |
3300031897|Ga0318520_10206832 | Not Available | 1159 | Open in IMG/M |
3300031897|Ga0318520_10207978 | Not Available | 1156 | Open in IMG/M |
3300031912|Ga0306921_10508140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1401 | Open in IMG/M |
3300031939|Ga0308174_11142926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
3300031941|Ga0310912_10126500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1909 | Open in IMG/M |
3300031946|Ga0310910_10739529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
3300031954|Ga0306926_10459586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1568 | Open in IMG/M |
3300031962|Ga0307479_11623156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
3300031965|Ga0326597_10062567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4623 | Open in IMG/M |
3300032001|Ga0306922_11339283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
3300032009|Ga0318563_10808031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300032025|Ga0318507_10546150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300032035|Ga0310911_10176082 | Not Available | 1211 | Open in IMG/M |
3300032054|Ga0318570_10011621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3100 | Open in IMG/M |
3300032059|Ga0318533_10199595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1432 | Open in IMG/M |
3300032063|Ga0318504_10048459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1775 | Open in IMG/M |
3300032066|Ga0318514_10392799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300032091|Ga0318577_10347115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
3300032091|Ga0318577_10560653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300032094|Ga0318540_10083793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1481 | Open in IMG/M |
3300032261|Ga0306920_100542085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1724 | Open in IMG/M |
3300032261|Ga0306920_100798341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1386 | Open in IMG/M |
3300032770|Ga0335085_11284524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
3300032783|Ga0335079_10806933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 972 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.35% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.61% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.61% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.61% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.74% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.87% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.87% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.87% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.87% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.87% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0063454_1014295752 | 3300004081 | Soil | AGELREALACAIAARAREVALATICGKSAVEVAIVDRQGGFLARVGA* |
Ga0066675_108320652 | 3300005187 | Soil | LARAVAGRAREVALATLCGKTTVELAVVDRQGGFVARVGG* |
Ga0070667_1015977951 | 3300005367 | Switchgrass Rhizosphere | AVARQAREVALATLSGDTAVEVAIVNRDGRLLALVGGAA* |
Ga0070708_1007265772 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAAVARQAREVALATLSGKTAVEVAIVGRAGDFLARVGAEA* |
Ga0066692_107745832 | 3300005555 | Soil | ARQAREVALATLSGKTAVEVAIVGRAGDFLARVGVEA* |
Ga0066654_109197152 | 3300005587 | Soil | RAREVALATLSGATAVEVAIVDRSREFLARVGAQG* |
Ga0068864_1010276961 | 3300005618 | Switchgrass Rhizosphere | AEAVARQAREVALATLSGDTAVEVAIVNRDGRLLALVGGAA* |
Ga0066903_1013332451 | 3300005764 | Tropical Forest Soil | EVALATLSGAIAVEVAIVGRSGEFLARVGAEAPP* |
Ga0066903_1024029451 | 3300005764 | Tropical Forest Soil | TVAAQAREVALATLSGETAIEVAIIDRQGEIMARVGG* |
Ga0073928_106898851 | 3300006893 | Iron-Sulfur Acid Spring | GELRKALACAVARRAREVALATLSGNTNVEVAVVDRRGGLLARVGS* |
Ga0075436_1013190421 | 3300006914 | Populus Rhizosphere | AAQAREVALATLCGETAIEVAVVDRRGGIVARVGEWPRGVC* |
Ga0079219_120289831 | 3300006954 | Agricultural Soil | AGRAREVALATICGKTAVEVAIVDRQGSFVARVGA* |
Ga0079218_115505152 | 3300007004 | Agricultural Soil | DVSGEHRPALAEAVARQAREVALATLPGDTEVEVAIVDRDGCFLARVGERVA* |
Ga0075435_1008563802 | 3300007076 | Populus Rhizosphere | LAAAVARQAREVALATLSGATAVEVAIVGRDGEFLARVGAAS* |
Ga0099793_106654761 | 3300007258 | Vadose Zone Soil | GSKRGAFAGGVAVRAREVALATLCGKTAIEVAIVDRQGDFLARVGG* |
Ga0126373_101560891 | 3300010048 | Tropical Forest Soil | AAGPLASVLAEGVAYRAREVALATLSGATAVEVAIVDRSGEFLARVGA* |
Ga0126373_105681651 | 3300010048 | Tropical Forest Soil | ALARVVAARAREVALATISGEIAVEVAIVDRQGEIMARVGE* |
Ga0126373_107588983 | 3300010048 | Tropical Forest Soil | ALAGARKEGLARLVAVRAREVALATLSGKTAVEVAIVDREGVFLARVGG* |
Ga0134062_103312982 | 3300010337 | Grasslands Soil | AALAEAVARQAREVALATLSGATAVELAIVDRTGDFLARVGTES* |
Ga0126381_1024709111 | 3300010376 | Tropical Forest Soil | LADGVARRAREVALATLSGAIAVEVAIVGRSGEFLARVGAEAPP* |
Ga0126381_1050948101 | 3300010376 | Tropical Forest Soil | MAPILAEAVAYGAREVALATLSGATAVEVAIVDRSGEFLARVGA* |
Ga0134124_122109762 | 3300010397 | Terrestrial Soil | EADSAGAMLDLAGERRDALAEAVARQARVVALATLSGATAVEVAIVGRDGEFLARVGATS |
Ga0126383_127201711 | 3300010398 | Tropical Forest Soil | ALAGSRKEGLARLVAVRAREVALATLSGKTAVEVAIVDREGVFLARVGG* |
Ga0126350_105303473 | 3300010880 | Boreal Forest Soil | REVALATLSGATAVEVAIVDRAGEFLARVGDEAPQ* |
Ga0137376_110013012 | 3300012208 | Vadose Zone Soil | AIARRAREVALATLSGAIAVEVAIVDRSGDFLARVGAEA* |
Ga0164302_115443301 | 3300012961 | Soil | AREVALATLSGATAVEVAIVGRDGEFLARVGAAS* |
Ga0157374_127052092 | 3300013296 | Miscanthus Rhizosphere | RPALAAAVARQAREVALATLSGDIAVEVAIVDRGGAFLARVGGPPV* |
Ga0182036_104388583 | 3300016270 | Soil | AAQAREVALATLCGKTAIEVAIVDRQGSFLARVGG |
Ga0182036_119228762 | 3300016270 | Soil | AGSREGALARLVAARAREVALATLSGKTTVEVAIVDREGEFLARVGG |
Ga0182041_100972861 | 3300016294 | Soil | LAAAHRADLARLVAARAREVALATLSGKTAVEVAIVDRDAEFLARVGG |
Ga0182035_111254081 | 3300016341 | Soil | VLALAEGREGALARLVAARAREVALATLSGKTAVEVAVVDRAGEFLARVGW |
Ga0182034_102589383 | 3300016371 | Soil | AQRAALAGIVAARAREVALATLSGKTAVEVAIVDREAEFLARVGG |
Ga0182037_108943662 | 3300016404 | Soil | AARAREVALATLSGKTAVELAIVDREGVFLALVCG |
Ga0182037_109520922 | 3300016404 | Soil | SREGALARLVAARAREVALATLSGKTTLEVAIVDREGEFLARVGG |
Ga0182039_109726111 | 3300016422 | Soil | EIRALASSRERALARLVAARAREVALAILSGKNTVEVAIVDREGEFLARVGG |
Ga0182038_101937923 | 3300016445 | Soil | AEILALAGGREGALARLVAAGAREVALATLSDKTAVEVAIVDREGGFLARVGG |
Ga0187817_106004052 | 3300017955 | Freshwater Sediment | DVAGRWRATLADNVARRARSVALATLSGATAVEVAIVDRGGNFLARVGA |
Ga0187815_104200422 | 3300018001 | Freshwater Sediment | LAHGVARQAREVALATLSGKTAIDVAVIDRDGNLLGRAGW |
Ga0066655_101929221 | 3300018431 | Grasslands Soil | QAREVALATLSGATAVEVAIVSRDGEFLGRVGAMR |
Ga0066655_102638363 | 3300018431 | Grasslands Soil | EALAAAVARRAREVAMATLSGHTAVEVAIVDRGGGFLARIGA |
Ga0210405_101618121 | 3300021171 | Soil | GDRSTALAGQVAARAREVALATLSGKTAVEVAIVDRAGDFLARVGAEA |
Ga0210394_103196751 | 3300021420 | Soil | ARRAREVALATLSGATAVEIAIVDRGGEFLARVGA |
Ga0210402_115307401 | 3300021478 | Soil | LAGGRRKALARLVAARAREMALATLSGRTEIEVAVVDRTGEFLARVGG |
Ga0126371_116331602 | 3300021560 | Tropical Forest Soil | EIAGRARKIALRMLGGRTAVEVAIVDRQGEVLARGR |
Ga0242655_102551351 | 3300022532 | Soil | IAGRAREVALATICGKTAVEVAIVDRQGSFLARVGG |
Ga0224549_10169611 | 3300022840 | Soil | NVLADGVARRAREVALATLSGATEVEVAIVDRGGEFLSRVGG |
Ga0207692_104647421 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ARAIAGRAREVALATICGKTAVEVAIVDRQGGVLARVGT |
Ga0207663_102752291 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAVARQAREVALATLSGATAVEVAIVGRDGEFLARVGAAS |
Ga0207676_109823271 | 3300026095 | Switchgrass Rhizosphere | PALAEAVARQAREVALATLSGDTAVEVAIVNRDGRLLALVGGAA |
Ga0209265_12121481 | 3300026308 | Soil | TIAWRAREVALATICGKTAVEIAIVDRLGNFLARVGG |
Ga0209159_11705792 | 3300026343 | Soil | ERREALAEAVGWQAREVALATLSGATAVEVAIVGRDGEFLGRVGAMT |
Ga0257147_10511832 | 3300026475 | Soil | REALAHGIAAQAREVALATLCGKTAIEVAIIDRQGSFLARVGG |
Ga0208981_10326163 | 3300027669 | Forest Soil | AAAIARQAREVALATLSGATAVEIAVVDRAGDFLARVGAEA |
Ga0209810_12011392 | 3300027773 | Surface Soil | AREVALATLSGDTAVEVAIVDRGGALLARVGQPAEAAR |
Ga0209167_105434782 | 3300027867 | Surface Soil | ALAHAVAGRAREVALATLAGGISVEVAVVDRDGGLLARAGG |
Ga0209283_109558632 | 3300027875 | Vadose Zone Soil | YGTALAAAVARQAREVALATLCGDTLVEVAIVDRGGDFLARVGGP |
Ga0209415_101536631 | 3300027905 | Peatlands Soil | ADGVARRARAVALATLSGATAVEVAIVDRGGDFLARAGAEVKR |
Ga0209415_105343442 | 3300027905 | Peatlands Soil | LRTALARRVAEGCREVALATLAGGIAVDVAVFDREGSFLAGTEA |
Ga0209415_105343452 | 3300027905 | Peatlands Soil | LRTALARRVAEGCREVALATLAGGIAVDVAVFDREGSLLAGTEA |
Ga0307305_103964681 | 3300028807 | Soil | VGWQAREVALATLSGATAVEVVIVGRNGEFLGRVGAIT |
Ga0307482_12896401 | 3300030730 | Hardwood Forest Soil | RAIAGRAREVALATISGKTAVEVAIVDRQGTFLACVGM |
Ga0302308_106387002 | 3300031027 | Palsa | ARRAREVALATLSGATEVEVAIVDRGGEFLSRVGG |
Ga0170824_1007767721 | 3300031231 | Forest Soil | VAARAREMALATLSGRTEIEVAVVDRTGEFLARVGG |
Ga0302325_122120361 | 3300031234 | Palsa | GTWAPALADGVARRAREVALATLSGTVAVEVAIVDRDGDFLARVGT |
Ga0302326_134321891 | 3300031525 | Palsa | WAPALADGVARRAREVALATLSGTVAVEVAIVDRDGDFLARVGT |
Ga0318573_100515781 | 3300031564 | Soil | LAGGRREPLAAMVAARAREVALATLCGKTAVEVAIVDRQGGFLARVGG |
Ga0318515_105266251 | 3300031572 | Soil | EALASLVAARAREVALATLSGRTAVEVAIVDREAEFLARVGG |
Ga0310915_101920973 | 3300031573 | Soil | VAARAREVALAALSGETAVEVAIVDREGEFLARVGG |
Ga0318555_101302641 | 3300031640 | Soil | GAAEILALAGDRRGALARAVAVRAREVALATLSGRTVVEIAIVDRDGGFLARVDE |
Ga0318561_100481061 | 3300031679 | Soil | GALARAVAVRAREVALATLSGRTVVEIAIVDRDGGFLARVDE |
Ga0318561_100948123 | 3300031679 | Soil | LARLVAGGAREVALATLSGKTAVEVAIVDRQGCFLARVGG |
Ga0318572_108313861 | 3300031681 | Soil | DLARLVAARAREVALATLSGKTAVEVAIVDRDAEFLARVGG |
Ga0318572_108671411 | 3300031681 | Soil | LVAARAREVALATLSGKTTVEVAIVDREGEFLARVGG |
Ga0318560_107034552 | 3300031682 | Soil | LARLVAARAREVAVATLSGKTTLEVAIVDRGGEFLARVGG |
Ga0307476_109454072 | 3300031715 | Hardwood Forest Soil | LEAAGSWAPALADGVARRAREVALATLSGATAVEIAIVDRGGEFLARVGAEGQP |
Ga0306917_102218953 | 3300031719 | Soil | LALAATRGEALASLVAARAREVALATLSGRTAVEVAIVDREAEFLARVGG |
Ga0318501_105600541 | 3300031736 | Soil | RKRHLARLVAGGAREVALATLSGKTAVEVAIVDRQGCFLARVGG |
Ga0307477_108511911 | 3300031753 | Hardwood Forest Soil | LAGGRRPALARDVARRAREVALATLGGGTAIEVAIIERGGDLLALVGE |
Ga0307475_103838723 | 3300031754 | Hardwood Forest Soil | ALAGSREGALARLVAVRAREVALATLSGKTAVEVTIVDREGEFLARVGG |
Ga0318535_100134301 | 3300031764 | Soil | GRREPLAAMVAARAREVALATLCGKTAVEVAIVDRQGGFLARVGG |
Ga0318509_101296043 | 3300031768 | Soil | AGALARLVAARAREVALATLSGKTAVEVAIVDREGIFLARVGW |
Ga0318546_103237971 | 3300031771 | Soil | ALAGSRERALARLVAARAREVALAALSGETAVEVAIVDREGEFLARVGG |
Ga0318529_105885552 | 3300031792 | Soil | AAHRADLARLVAARAREVALATLSGKTAVEVAIVDRDAEFLARVGG |
Ga0318548_101711471 | 3300031793 | Soil | TEGALARLVAAGAREVALATLSGKTAVEVAIVDRQGSFLARVGG |
Ga0318503_102279221 | 3300031794 | Soil | ALARLVAARAREVALATLSGKTTVEVAIVDREGEFLARVGG |
Ga0318568_105860702 | 3300031819 | Soil | EALASVVAARAREVALATLSGRTAVEVAIVDREAEFLARVGG |
Ga0318512_100681953 | 3300031846 | Soil | GTRREALARLVAGGAREVALATLSGKTAVEVAIVDRQGCFLARVGG |
Ga0306919_100754671 | 3300031879 | Soil | ARVVAAQAREVALATLCGKTAIEVAIVDRQGSFLARVGG |
Ga0306919_106822442 | 3300031879 | Soil | SRERALARLVAARAREVALAALSGETAVEVAIVDREGEFLARVGG |
Ga0318544_101692251 | 3300031880 | Soil | VIAGQAREVALATISGKTAVEVAIVDRQGSFLARVGM |
Ga0306925_104860841 | 3300031890 | Soil | QKEALAGLVAARAREVALATLSGKTTVEVAIVDREAEFLARVGG |
Ga0318520_102068321 | 3300031897 | Soil | RLVAARAREVALATLSGKTTVEVAIVDREGEFLARVGG |
Ga0318520_102079783 | 3300031897 | Soil | EALAGLVAAGAREVALATLSGKTAVEVAIVDRQGSFLARVGG |
Ga0306921_105081403 | 3300031912 | Soil | SGGKAAALARLVAARAREVALATLSGKTAVEVAIVDREGIFLARVGW |
Ga0308174_111429262 | 3300031939 | Soil | EAVARQAREVALAILSGATAVEVAIVGRDSEFLARVGAAS |
Ga0310912_101265004 | 3300031941 | Soil | EVLALAEGRHGALARLVAARAREVALATLSGKTAVEVAVVDRAGEFLARVGW |
Ga0310910_107395292 | 3300031946 | Soil | LARLVAARAREVALATLSGKTAVEVAIVDREGIFLARVGW |
Ga0306926_104595861 | 3300031954 | Soil | NTLARAIAGRAREVALATLCGKTAIEVAVVDRQGSFLARVGV |
Ga0307479_116231561 | 3300031962 | Hardwood Forest Soil | LDIAGEWRMPLADGVARGAREVALATLSGATAVEVAIVDRTGEFLARIGHG |
Ga0326597_100625671 | 3300031965 | Soil | TVARRAREVALATVSGGIAVEVAIVDRGGAFLARVGGAAWEDIAT |
Ga0306922_113392831 | 3300032001 | Soil | AARAREVALATLSGKTTVEVAIVDREAEFLARVGG |
Ga0318563_108080311 | 3300032009 | Soil | LALADGLQRDLARLVATRAREVALATLSGKTAVEVAVVDRTGEFLARVGW |
Ga0318507_105461502 | 3300032025 | Soil | VAARAREVSLAALSGETAVEVAIVDREGEFLARVGG |
Ga0310911_101760823 | 3300032035 | Soil | REGALARLVAGRAREVALATLSGKTAVEVAIVDREGELLARVGG |
Ga0318570_100116215 | 3300032054 | Soil | MVAARAREVALATLCGKTAVEVAIVDRQGGFLARVGG |
Ga0318533_101995951 | 3300032059 | Soil | LSLAAAHRADLARLVAARAREVALATLSGKTAVEVAIVDRDAEFLARVGG |
Ga0318504_100484594 | 3300032063 | Soil | REPLAAMVAARAREVALATLCGKTAVEVAIVDRQGGFLARVGG |
Ga0318514_103927992 | 3300032066 | Soil | VVAAQAREVALATLSCDIAVEVAIVDRQGDFLARVGG |
Ga0318577_103471152 | 3300032091 | Soil | ARLVAARAREVALATLSGKTAVEVAIVDREGRFLARVGW |
Ga0318577_105606531 | 3300032091 | Soil | RADLARLVAARAREVALATLSGKTAVEVAIVDRDAEFLARVGG |
Ga0318540_100837933 | 3300032094 | Soil | VAVRAREVALATLSGRTVVEIAIVDRDGGFLARVDE |
Ga0306920_1005420851 | 3300032261 | Soil | EGALARLVAARAREVALATLSGKTTLEVAIVDREGEFLARVGG |
Ga0306920_1007983411 | 3300032261 | Soil | KTLARAIARRAREVALATLCGKTALEVAVVDRQGSFLARVGV |
Ga0335085_112845241 | 3300032770 | Soil | DGVARRAREVALATLSGATAVEVAIIGRAGDVLARVGGEARP |
Ga0335079_108069331 | 3300032783 | Soil | RAALVDGIARRARAVALATLSGATAVEVAIVDRGGEFLARVGA |
⦗Top⦘ |