NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079549

Metagenome / Metatranscriptome Family F079549

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079549
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 43 residues
Representative Sequence MADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAAR
Number of Associated Samples 99
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 33.91 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.17 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.696 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.913 % of family members)
Environment Ontology (ENVO) Unclassified
(31.304 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.261 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 21.13%    Coil/Unstructured: 78.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF03934T2SSK 80.87
PF11612T2SSJ 9.57
PF12019GspH 1.74
PF01694Rhomboid 0.87
PF12833HTH_18 0.87
PF08334T2SSG 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG3156Type II secretory pathway, component PulKIntracellular trafficking, secretion, and vesicular transport [U] 80.87
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.17 %
UnclassifiedrootN/A7.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17056177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1073Open in IMG/M
2228664022|INPgaii200_c1014126All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1074Open in IMG/M
3300005336|Ga0070680_101200064Not Available656Open in IMG/M
3300005365|Ga0070688_100649268All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria812Open in IMG/M
3300005535|Ga0070684_100621389All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1005Open in IMG/M
3300005542|Ga0070732_10657957All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria637Open in IMG/M
3300005614|Ga0068856_100770888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria982Open in IMG/M
3300006028|Ga0070717_11664640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria578Open in IMG/M
3300009012|Ga0066710_100518728All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1799Open in IMG/M
3300010043|Ga0126380_11636875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria576Open in IMG/M
3300010159|Ga0099796_10221861All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria775Open in IMG/M
3300010359|Ga0126376_11489392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria705Open in IMG/M
3300010366|Ga0126379_11930492All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria693Open in IMG/M
3300010376|Ga0126381_103209353All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria646Open in IMG/M
3300010376|Ga0126381_103865861All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium584Open in IMG/M
3300010396|Ga0134126_12364270All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria579Open in IMG/M
3300010401|Ga0134121_13017638All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria518Open in IMG/M
3300012189|Ga0137388_10972409All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria784Open in IMG/M
3300012198|Ga0137364_11181499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria574Open in IMG/M
3300012285|Ga0137370_11008735All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria512Open in IMG/M
3300012361|Ga0137360_10669894All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria890Open in IMG/M
3300012917|Ga0137395_10210801All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1355Open in IMG/M
3300012930|Ga0137407_10731963All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria932Open in IMG/M
3300014168|Ga0181534_10308859All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria854Open in IMG/M
3300014169|Ga0181531_10981872Not Available530Open in IMG/M
3300015241|Ga0137418_10213122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola1661Open in IMG/M
3300015357|Ga0134072_10077886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria979Open in IMG/M
3300016371|Ga0182034_10490271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1023Open in IMG/M
3300017927|Ga0187824_10265908Not Available599Open in IMG/M
3300017936|Ga0187821_10294259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria644Open in IMG/M
3300017947|Ga0187785_10654004Not Available547Open in IMG/M
3300017970|Ga0187783_10785501All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria687Open in IMG/M
3300017974|Ga0187777_10642625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria750Open in IMG/M
3300017974|Ga0187777_11176176All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria560Open in IMG/M
3300017993|Ga0187823_10022174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1606Open in IMG/M
3300018007|Ga0187805_10463074All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria592Open in IMG/M
3300018058|Ga0187766_10150434All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1445Open in IMG/M
3300018058|Ga0187766_11390110Not Available515Open in IMG/M
3300019888|Ga0193751_1245734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria556Open in IMG/M
3300021168|Ga0210406_10124063All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2181Open in IMG/M
3300021372|Ga0213877_10130865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria782Open in IMG/M
3300021372|Ga0213877_10202346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium646Open in IMG/M
3300021405|Ga0210387_10243774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1571Open in IMG/M
3300021432|Ga0210384_10346492All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1338Open in IMG/M
3300021432|Ga0210384_10965685All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria753Open in IMG/M
3300021477|Ga0210398_10061346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3072Open in IMG/M
3300021559|Ga0210409_10142996All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2193Open in IMG/M
3300021560|Ga0126371_11560451All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria787Open in IMG/M
3300021560|Ga0126371_13187292All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria555Open in IMG/M
3300021560|Ga0126371_13516454All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria529Open in IMG/M
3300022894|Ga0247778_1102244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria762Open in IMG/M
3300024288|Ga0179589_10535716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea545Open in IMG/M
3300025571|Ga0207874_1083039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria668Open in IMG/M
3300025903|Ga0207680_10680180All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria737Open in IMG/M
3300025904|Ga0207647_10680707All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax562Open in IMG/M
3300025914|Ga0207671_10492203All Organisms → cellular organisms → Bacteria → Proteobacteria978Open in IMG/M
3300025915|Ga0207693_11243530All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium559Open in IMG/M
3300025916|Ga0207663_10228661All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1358Open in IMG/M
3300025916|Ga0207663_10987048All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria675Open in IMG/M
3300025939|Ga0207665_10030229All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales3580Open in IMG/M
3300026116|Ga0207674_11637321All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium612Open in IMG/M
3300026325|Ga0209152_10009839All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans3339Open in IMG/M
3300027590|Ga0209116_1075978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria734Open in IMG/M
3300027671|Ga0209588_1186205All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria650Open in IMG/M
3300028047|Ga0209526_10425603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria877Open in IMG/M
3300028380|Ga0268265_12068831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea576Open in IMG/M
3300028906|Ga0308309_11113162All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria682Open in IMG/M
3300029636|Ga0222749_10174948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1060Open in IMG/M
3300030739|Ga0302311_10912134All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria562Open in IMG/M
3300031545|Ga0318541_10658772Not Available585Open in IMG/M
3300031564|Ga0318573_10054409All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1963Open in IMG/M
3300031640|Ga0318555_10441988All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria705Open in IMG/M
3300031679|Ga0318561_10208637All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1060Open in IMG/M
3300031679|Ga0318561_10594031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria610Open in IMG/M
3300031715|Ga0307476_10105516All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1994Open in IMG/M
3300031719|Ga0306917_10520633All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria934Open in IMG/M
3300031753|Ga0307477_10135875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1716Open in IMG/M
3300031753|Ga0307477_10962974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea561Open in IMG/M
3300031770|Ga0318521_10159927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1283Open in IMG/M
3300031779|Ga0318566_10133041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1230Open in IMG/M
3300031780|Ga0318508_1031616All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1344Open in IMG/M
3300031781|Ga0318547_10044194All Organisms → cellular organisms → Bacteria → Proteobacteria2369Open in IMG/M
3300031781|Ga0318547_10927202Not Available544Open in IMG/M
3300031782|Ga0318552_10380375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria719Open in IMG/M
3300031782|Ga0318552_10629516Not Available547Open in IMG/M
3300031794|Ga0318503_10177955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria688Open in IMG/M
3300031794|Ga0318503_10203920All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria641Open in IMG/M
3300031795|Ga0318557_10190386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria935Open in IMG/M
3300031795|Ga0318557_10576338Not Available516Open in IMG/M
3300031819|Ga0318568_10014247All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4190Open in IMG/M
3300031821|Ga0318567_10110333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1496Open in IMG/M
3300031823|Ga0307478_10067247All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2701Open in IMG/M
3300031831|Ga0318564_10338407All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria662Open in IMG/M
3300031860|Ga0318495_10070553All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1557Open in IMG/M
3300031879|Ga0306919_10748653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria752Open in IMG/M
3300031893|Ga0318536_10119690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1329Open in IMG/M
3300031897|Ga0318520_10275448All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1009Open in IMG/M
3300031954|Ga0306926_11902813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria672Open in IMG/M
3300031959|Ga0318530_10044251All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1653Open in IMG/M
3300031962|Ga0307479_12071849All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium517Open in IMG/M
3300032008|Ga0318562_10070358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1950Open in IMG/M
3300032025|Ga0318507_10094380All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1241Open in IMG/M
3300032025|Ga0318507_10118005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1118Open in IMG/M
3300032066|Ga0318514_10282915All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria875Open in IMG/M
3300032066|Ga0318514_10471900All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria667Open in IMG/M
3300032067|Ga0318524_10349471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria768Open in IMG/M
3300032089|Ga0318525_10379213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria725Open in IMG/M
3300032091|Ga0318577_10249302All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria850Open in IMG/M
3300032180|Ga0307471_101333500All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria879Open in IMG/M
3300032783|Ga0335079_11041365All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria832Open in IMG/M
3300032829|Ga0335070_10267538All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1669Open in IMG/M
3300032896|Ga0335075_10368262All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1551Open in IMG/M
3300032898|Ga0335072_11535592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea566Open in IMG/M
3300033158|Ga0335077_10200323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2246Open in IMG/M
3300033289|Ga0310914_11333002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria620Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.35%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.74%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.87%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.87%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025571Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes)EngineeredOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_018926902088090014SoilMADXXXLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLA
INPgaii200_101412612228664022SoilMADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAAR
Ga0070680_10120006413300005336Corn RhizosphereMADWLLLRLPRAPEQSATWLIVDLRGAPTGPPQGGPLALAAARAAG
Ga0070688_10064926813300005365Switchgrass RhizosphereMADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPRAVG
Ga0070684_10062138913300005535Corn RhizosphereMADWLLLRLPRDPEQPATWLVVDARGVAQGPPQSGPLSLAAPRSAGR
Ga0070732_1065795713300005542Surface SoilMADWLLLRLPHAGSELATWLVVDARGAPLSPPQSGPLALAAAR
Ga0068856_10077088813300005614Corn RhizosphereMADWLLLRLPRTPAQSATWLVVDPRGTPAGPPQSGPLSLAAPRTAGR
Ga0070717_1166464013300006028Corn, Switchgrass And Miscanthus RhizosphereMADWLLLRLPRTPDQAATWLVVDARGVAQGPPQSGP
Ga0066710_10051872813300009012Grasslands SoilMADWLLLRLPRASGEPASWLVADARGAPAGPPQDGPLTLAAPRA
Ga0126380_1163687523300010043Tropical Forest SoilMADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAA
Ga0099796_1022186113300010159Vadose Zone SoilMADWLLIRLPRTPEQAVTWLTVDPRGNPSGPPQSGPL
Ga0126376_1148939223300010359Tropical Forest SoilMADWLLLRLPHAGADLATWLVVDARGAPLSPPQSGPLALAAARV
Ga0126379_1193049213300010366Tropical Forest SoilMAESLLLRLPRSPEHAATWLVVDARGVPTGPPQSGPLALA
Ga0126381_10320935313300010376Tropical Forest SoilMADWLLLRLPRADAELATWLVVDSRGAPISPPQSGPLGLAAAR
Ga0126381_10386586123300010376Tropical Forest SoilMADWLLLRLPRTPEQPVSWVVVDPRGNPSGPVLSGPVSLAAPRAAG
Ga0134126_1236427013300010396Terrestrial SoilMADWLLLRLPRIPDQPATWLVVDPRGVAQGPPQSGPLSLAAPRTAGRRI
Ga0134121_1301763813300010401Terrestrial SoilMADWLLLRLPRIPDQPATWLVVDPRGVAQGPPQSGP
Ga0137388_1097240923300012189Vadose Zone SoilMADWLLLRLPRAPEQLASWLVADARGASAGLAQAGPL
Ga0137364_1118149913300012198Vadose Zone SoilMADWLLLRLPRTPDQAATWLVVDPRGVAQGPPQSGPLTLAAPRAT
Ga0137370_1100873513300012285Vadose Zone SoilMADWLLLRLPRAAGEPASWLIADARGAPAGPPQSGPLTLAAARAPGRRVC
Ga0137360_1066989413300012361Vadose Zone SoilMADWLLLRLPRAPEEPASWLVADVRGAPAGPPQGGPLSLAAARAA
Ga0137395_1021080113300012917Vadose Zone SoilMADWLLLRLPRAPEGPASWLVADARGAPVGPPQSGPLSLAAARAAG
Ga0137407_1073196313300012930Vadose Zone SoilMADWLLLRLPHAPEEPASWLVADARGAPVGPPQSGPLSLAAARAAG
Ga0181534_1030885913300014168BogVAESLLLRLPHDPQRAASWLIVDARGTPVGPPMSGPLNLAAARIGGRQ
Ga0181531_1098187223300014169BogMAETLLLRLPHGADQAPTWLIVDARGAAVGPPQSGPLNL
Ga0137418_1021312213300015241Vadose Zone SoilMADWLLIRLPRTPEQPATWLTVDPRGSPSGPPQSGPLSLAA
Ga0134072_1007788623300015357Grasslands SoilMADWLLLRLPRAAGEPASWLIADARGAPAGPQQSGPLTLAAARA
Ga0182034_1049027113300016371SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPL
Ga0187824_1026590813300017927Freshwater SedimentMADWLLLRLPRTPDQAATWLVVDPRGVPTGPPQGGPLSLAAAR
Ga0187821_1029425923300017936Freshwater SedimentMADWLLLRLPRTPEGPAAWLIASPAGAPLTATQSG
Ga0187785_1065400413300017947Tropical PeatlandVAETLLLRLPRAPEQLATWLVVDSGGAPTGPPQSGP
Ga0187783_1078550123300017970Tropical PeatlandMSDWLLLRLPRQPDQLPSWLVTDVRGAPLGPPQGGPLELAA
Ga0187777_1064262513300017974Tropical PeatlandMADWLLLRLPHADAELATWLVVDAHGAPLSPPQSGPL
Ga0187777_1117617623300017974Tropical PeatlandMADWLLLRLPREETELATWLVVDSRGAPSSPPQSG
Ga0187823_1002217433300017993Freshwater SedimentMADWLLLRLPRAPEQSATWLIVDPRGAPTGPPQGGPLTLAAARAAGRRVAVLV
Ga0187805_1046307413300018007Freshwater SedimentMSDWLLLRLPPSGAELATWLVVDARGAPLSPPQSGPLA
Ga0187766_1015043433300018058Tropical PeatlandMPDWLLLRLPRQPDQLSSWLVTDARGAPLGPPQSGPLPLAA
Ga0187766_1139011023300018058Tropical PeatlandMPDWLLLRLARQPDQLSSWLVTDARGAPLGPPQSGPLPLAA
Ga0193751_124573423300019888SoilMADWLLLRLPRAPELPATWLVVDSRGAPTGPPQAGPLSLATPRA
Ga0210406_1012406343300021168SoilMSDWLLLRLPHADAELATWLVVDARGAPISPPQSG
Ga0213877_1013086523300021372Bulk SoilMSDWLLLRLPHAGTELATWLVVDARGAPLGPAQSGPLALAAPRVPGRRV
Ga0213877_1020234623300021372Bulk SoilMAEWLLIRLPRTPEEPATWVVADARGAVSGPPQSGPLTL
Ga0210387_1024377413300021405SoilMADWLLLRLPRVPDQPATWLVVDPKGVATGPPQSG
Ga0210384_1034649213300021432SoilMADWLLLRLPRAPEQAATWLVVDARGTPTGAPQSGPLSLAA
Ga0210384_1096568513300021432SoilMADWLLLRLPRAPEEPASWLVADARGAPAGPPQSGPLSLAA
Ga0210398_1006134613300021477SoilMAETLLLRLPHAADEAASWLIVDGRGAPVGPPQSGPLNLAAPRVAGRR
Ga0210409_1014299643300021559SoilMAEWLLLRLPRAPEEPASWLVADARGAPVGPPQSGPLSLAAARAVG
Ga0126371_1156045113300021560Tropical Forest SoilMAETLLLRMPRAPGQNAGWLIVDARGAPVGPPQAGP
Ga0126371_1318729213300021560Tropical Forest SoilMADWLLLRLPRTDTELAVWLLVDARGAPASPPQSGPLSLAASRAPGRRVGL
Ga0126371_1351645413300021560Tropical Forest SoilMSDWLLLRLPHAPDQPASWLVADARGAPMGPPQAGPLELAAPRVSGRRVC
Ga0247778_110224413300022894Plant LitterMADWLLIRLPRTAEQPATWLTIDPRGNPSGPPQSGPLSLAAPRAVGGAFV
Ga0179589_1053571623300024288Vadose Zone SoilMADWLLIRLPRTPERPATWLTVDPRGNPSGPPQSGPLSLATP
Ga0207874_108303923300025571Ionic Liquid And High Solid EnrichedMADWLLLRLPRAPEQPASWISVDARGAVQDGPHSGPLTLAATQAA
Ga0207680_1068018013300025903Switchgrass RhizosphereMADWLLIRLPRTPEHPATWLTVDPRGNPSGPPQSG
Ga0207647_1068070713300025904Corn RhizosphereMADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPRAAG
Ga0207671_1049220323300025914Corn RhizosphereMADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPR
Ga0207693_1124353013300025915Corn, Switchgrass And Miscanthus RhizosphereMADWLLLRLPRSADQPATWLIVDPRGNAVGPPQSGPLSLAAP
Ga0207663_1022866133300025916Corn, Switchgrass And Miscanthus RhizosphereMAESLLLRLPRDPEQAASWLIVDARGAPVGPPQSGPLNLA
Ga0207663_1098704813300025916Corn, Switchgrass And Miscanthus RhizosphereMADWLLLRLPREETELATWLVVDSRGTPSSPPQSGPLALAAA
Ga0207665_1003022963300025939Corn, Switchgrass And Miscanthus RhizosphereMADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLA
Ga0207674_1163732123300026116Corn RhizosphereMADWLLLRLPRSPEQPASWLIVDPRGAASGPPQSGPLSLAAARAPGRRICVL
Ga0209152_1000983963300026325SoilMADWLLLRLPRAAGEPASWLIADARGAPAGPAQSGPLTLAAARAPGRRV
Ga0209116_107597823300027590Forest SoilMADWLLLRLPHAAEQPATWLTADARGAPTGLAQSGPLSL
Ga0209588_118620513300027671Vadose Zone SoilMADWLLLRLPRAPEGPASWLVADARGAPVGPPQSGPLSLAAAR
Ga0209526_1042560323300028047Forest SoilMADWLLLRLPRAPEEPASWLVADARGAPAGPPQSGPLSLAAARA
Ga0268265_1206883113300028380Switchgrass RhizosphereMADWLLIRLPRTAEQPATWLTVDPRGNPSGPPQSGPLSLAAPRA
Ga0308309_1111316223300028906SoilMSDWLLLRLPRTPDQPASWLVTDARGTPSGPPQSGPLN
Ga0222749_1017494823300029636SoilMAEWLLLRLPRAPEEPASWLVADARGAPVGPPQSGPLSLAA
Ga0302311_1091213423300030739PalsaMSDWLLLRLPRTPDQPASWLVTDARGAPSGPPQSGPLSLAVPRA
Ga0318541_1065877223300031545SoilMADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAARAPGRRVCLLV
Ga0318573_1005440913300031564SoilMADWLLLRLPRAGTELATWLVVDARGAPLSPPQSGPLALAAARVPGRRVC
Ga0318555_1044198813300031640SoilMSDWLLLRLPRAPEQPATWLVVDPRGVALGPPQAGPLSLAAPRIAGRR
Ga0318561_1020863713300031679SoilMSDWLLLRLPHAGAELATWLVVDARGAPMSPPQSGPLALAAPRVPGRRV
Ga0318561_1059403113300031679SoilMSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLALAAPRV
Ga0307476_1010551613300031715Hardwood Forest SoilMAETLLLRLPHAADEAASWLIVDGRGAPVGPPQSGPLNLAAPRVAG
Ga0306917_1052063313300031719SoilMSDWLLLRLPHAGAELATWLVVDARGAPMSPPQSGPLALA
Ga0307477_1013587513300031753Hardwood Forest SoilMADWLLLRLPRAPEQPATWLVADARGTATGPPQSGPLSLAAPRTAG
Ga0307477_1096297423300031753Hardwood Forest SoilMADWLLIRLPRTPEQPATWLTVDPRGNPSGPPQSGPLSLAAPRSVGR
Ga0318521_1015992713300031770SoilMSDWLLLRLPQAGAELATWLVVDARGAPLSPPQSGPLA
Ga0318566_1013304123300031779SoilMSDWLLLRLPHAGVELASWLVVDARGAPLSPPQSGPLALAAPRT
Ga0318508_103161613300031780SoilMSDWLLLRLPRADTELATWLVVDARGAPLSPPQSGPLALA
Ga0318547_1004419443300031781SoilMSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARAPGRRVC
Ga0318547_1092720223300031781SoilMSDWLLLRLPRAPEQPATWLVVDPRGVALGPPQAGPLSLAAPRIA
Ga0318552_1038037523300031782SoilMSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARTTGRRVCV
Ga0318552_1062951613300031782SoilMADWLLLRLPRADAELATWLVVDARGAPISPPQSGPLGLAAARAPGRRVC
Ga0318503_1017795513300031794SoilMSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLA
Ga0318503_1020392023300031794SoilMADWLLLRLPRADAELATWLVVDARGAPISPPQSG
Ga0318557_1019038623300031795SoilMSDWLLLRLPRADTELATWLVVDARGAPLSPPQSGPLALAAARVPGR
Ga0318557_1057633823300031795SoilMSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARTTGRRVC
Ga0318568_1001424713300031819SoilMSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARTTG
Ga0318567_1011033313300031821SoilMSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLALAAPRAS
Ga0307478_1006724753300031823Hardwood Forest SoilMADWLLLRLPRVPDEPATWLVVDARGTSVGPPQGGPLTLAAARTAGRRV
Ga0318564_1033840723300031831SoilMPDWLLLRLPREDAELATWLVVDARGAPLSPPQSGPLALAAARIPG
Ga0318495_1007055313300031860SoilMSDWLLLRLPREDAELATWLVIDARGAPLGPPQSG
Ga0306919_1074865313300031879SoilMSDWLLLRLPRADTELATWLVVDARGAPLSPPQSGPLALAAARVP
Ga0318536_1011969013300031893SoilMSDWLLLRLPHTDTELATWLVVDARGAPLSPPQSGPLALAAPRVPG
Ga0318520_1027544813300031897SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAAPRAPGRRVAV
Ga0306926_1190281313300031954SoilMADWLLLRLPRTDTELAVWLLVDARGAPASPPQSGP
Ga0318530_1004425133300031959SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLA
Ga0307479_1207184923300031962Hardwood Forest SoilMADWLLLRLPRSPEQLATWLVVDARGVAVGPPQSGPLSLAAARTAGRRVCV
Ga0318562_1007035833300032008SoilMADWLLLRLPRAGTELATWLVVDARGAPLSPPQSGPLALAAARVPG
Ga0318507_1009438023300032025SoilMADWLLLRLPRAGTELATWLVVDARGAPLSPPQSGPLALAAARVPGRR
Ga0318507_1011800513300032025SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALA
Ga0318514_1028291523300032066SoilMSDWLLLRLPREDAELATWLVIDARGAPLGPPQSGPLALAAARAPGR
Ga0318514_1047190013300032066SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAA
Ga0318524_1034947123300032067SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAAP
Ga0318525_1037921313300032089SoilMSDWLLLRLPQAGAELATWLVVDARGAPLSPPQSGPLALAA
Ga0318577_1024930223300032091SoilMSDWLLLRLPHAGAELATWLVVDARGAPLSPPQSGPLALAAPRTPGRRVAVL
Ga0307471_10133350013300032180Hardwood Forest SoilMADWLLLRLARTQEEPATWLVVDARGVPLGPAQSGPLALAAPRT
Ga0335079_1104136523300032783SoilMADWLLLRLPREETELATWLVVDSRGTPSSPPQSGPLA
Ga0335070_1026753833300032829SoilMAESLLLRLPRTPEEQASWLIVDTRGTPVGPPQSGPLNLAAPRVTGRRVLVV
Ga0335075_1036826233300032896SoilMADWLLLRLPRTPQQQATWLIVDGRGAAIGPPQGGPLSLAAPRA
Ga0335072_1153559213300032898SoilMADWLLLRLPRTPDQPATWLVVDPRGAAAGPPQSGPLSLAAARSAGRRIC
Ga0335077_1020032343300033158SoilMAETLLLRLPRDPGHAPSWLIVDARGAAVGPPQSGPLNLAAPRVAG
Ga0310914_1133300223300033289SoilMPDWLLLRLPREDAELATWLVVDARGAPLRPPQSGPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.