NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F079219

Metagenome Family F079219

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079219
Family Type Metagenome
Number of Sequences 116
Average Sequence Length 94 residues
Representative Sequence KKSARQVRLNKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKDGSLGCIVDTFTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Number of Associated Samples 78
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.10 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.345 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(59.483 % of family members)
Environment Ontology (ENVO) Unclassified
(93.103 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(99.138 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.81%    β-sheet: 30.25%    Coil/Unstructured: 52.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF00856SET 6.90
PF10544T5orf172 1.72
PF08291Peptidase_M15_3 0.86



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.21 %
UnclassifiedrootN/A13.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001346|JGI20151J14362_10219599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium508Open in IMG/M
3300001450|JGI24006J15134_10050508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1702Open in IMG/M
3300004278|Ga0066609_10134377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium803Open in IMG/M
3300006029|Ga0075466_1154890Not Available588Open in IMG/M
3300006164|Ga0075441_10121930Not Available993Open in IMG/M
3300006484|Ga0070744_10122874All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium748Open in IMG/M
3300006735|Ga0098038_1080504All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1143Open in IMG/M
3300006737|Ga0098037_1216252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300006802|Ga0070749_10547701Not Available627Open in IMG/M
3300006869|Ga0075477_10294213Not Available646Open in IMG/M
3300006874|Ga0075475_10043465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2133Open in IMG/M
3300006919|Ga0070746_10302337Not Available735Open in IMG/M
3300006920|Ga0070748_1306951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300007539|Ga0099849_1328602All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium547Open in IMG/M
3300007667|Ga0102910_1096344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium686Open in IMG/M
3300009476|Ga0115555_1399965All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium547Open in IMG/M
3300009537|Ga0129283_10126345Not Available1050Open in IMG/M
3300010149|Ga0098049_1240265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300010296|Ga0129348_1125804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium895Open in IMG/M
3300012920|Ga0160423_10843165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300014959|Ga0134299_1058690All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium546Open in IMG/M
3300014973|Ga0134293_1045415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300017704|Ga0181371_1043330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium734Open in IMG/M
3300017704|Ga0181371_1078275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300017705|Ga0181372_1024273All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1032Open in IMG/M
3300017705|Ga0181372_1064930All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium617Open in IMG/M
3300017705|Ga0181372_1070196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300017705|Ga0181372_1074362All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300017706|Ga0181377_1019212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1511Open in IMG/M
3300017709|Ga0181387_1035953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium975Open in IMG/M
3300017709|Ga0181387_1138882All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300017710|Ga0181403_1136090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300017713|Ga0181391_1140086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300017714|Ga0181412_1075566All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium816Open in IMG/M
3300017717|Ga0181404_1027885All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1451Open in IMG/M
3300017720|Ga0181383_1048180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1144Open in IMG/M
3300017720|Ga0181383_1091966Not Available814Open in IMG/M
3300017721|Ga0181373_1016408All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1384Open in IMG/M
3300017721|Ga0181373_1065383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300017721|Ga0181373_1071921Not Available617Open in IMG/M
3300017721|Ga0181373_1083013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300017724|Ga0181388_1052680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium982Open in IMG/M
3300017727|Ga0181401_1160720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300017728|Ga0181419_1057810All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium999Open in IMG/M
3300017728|Ga0181419_1175815All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300017729|Ga0181396_1067143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium719Open in IMG/M
3300017729|Ga0181396_1082384All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium651Open in IMG/M
3300017729|Ga0181396_1113792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium556Open in IMG/M
3300017730|Ga0181417_1167258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300017731|Ga0181416_1023982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1431Open in IMG/M
3300017731|Ga0181416_1059321All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium904Open in IMG/M
3300017731|Ga0181416_1147276All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300017731|Ga0181416_1187054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300017737|Ga0187218_1151270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium548Open in IMG/M
3300017738|Ga0181428_1016727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1691Open in IMG/M
3300017738|Ga0181428_1111015Not Available642Open in IMG/M
3300017739|Ga0181433_1149546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium550Open in IMG/M
3300017739|Ga0181433_1157095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300017740|Ga0181418_1181094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300017742|Ga0181399_1130507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium611Open in IMG/M
3300017742|Ga0181399_1135192Not Available598Open in IMG/M
3300017743|Ga0181402_1052582Not Available1096Open in IMG/M
3300017745|Ga0181427_1016404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1854Open in IMG/M
3300017745|Ga0181427_1039739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1169Open in IMG/M
3300017745|Ga0181427_1078105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium812Open in IMG/M
3300017746|Ga0181389_1193958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium526Open in IMG/M
3300017748|Ga0181393_1009300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3027Open in IMG/M
3300017749|Ga0181392_1214587All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300017752|Ga0181400_1035702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1584Open in IMG/M
3300017753|Ga0181407_1090524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium775Open in IMG/M
3300017757|Ga0181420_1008962All Organisms → cellular organisms → Bacteria3435Open in IMG/M
3300017757|Ga0181420_1066533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1139Open in IMG/M
3300017757|Ga0181420_1196228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300017757|Ga0181420_1232629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300017758|Ga0181409_1136617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300017758|Ga0181409_1227876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300017759|Ga0181414_1000156Not Available20202Open in IMG/M
3300017760|Ga0181408_1015188All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2153Open in IMG/M
3300017760|Ga0181408_1097030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium769Open in IMG/M
3300017762|Ga0181422_1116193Not Available831Open in IMG/M
3300017764|Ga0181385_1037746All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1519Open in IMG/M
3300017764|Ga0181385_1042964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1414Open in IMG/M
3300017764|Ga0181385_1087613All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium956Open in IMG/M
3300017764|Ga0181385_1118422All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium809Open in IMG/M
3300017764|Ga0181385_1180773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium637Open in IMG/M
3300017765|Ga0181413_1137804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300017765|Ga0181413_1183500All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300017770|Ga0187217_1198819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300017771|Ga0181425_1097584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium942Open in IMG/M
3300017771|Ga0181425_1192247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium642Open in IMG/M
3300017772|Ga0181430_1085902All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium946Open in IMG/M
3300017772|Ga0181430_1098344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium872Open in IMG/M
3300017772|Ga0181430_1187866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300017775|Ga0181432_1308193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300017776|Ga0181394_1041196All Organisms → Viruses → Predicted Viral1583Open in IMG/M
3300017781|Ga0181423_1118597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1029Open in IMG/M
3300017781|Ga0181423_1161913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium859Open in IMG/M
3300017781|Ga0181423_1284581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium612Open in IMG/M
3300017782|Ga0181380_1292390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium534Open in IMG/M
3300017783|Ga0181379_1028246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2237Open in IMG/M
3300017783|Ga0181379_1151008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium829Open in IMG/M
3300017786|Ga0181424_10143887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1023Open in IMG/M
3300020165|Ga0206125_10232165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium708Open in IMG/M
3300020388|Ga0211678_10026002All Organisms → cellular organisms → Bacteria2960Open in IMG/M
3300020388|Ga0211678_10367893Not Available576Open in IMG/M
3300020408|Ga0211651_10400888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300020470|Ga0211543_10509158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300022061|Ga0212023_1050595Not Available577Open in IMG/M
3300022164|Ga0212022_1005961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1600Open in IMG/M
(restricted) 3300023109|Ga0233432_10499573Not Available509Open in IMG/M
3300024348|Ga0244776_10150923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1692Open in IMG/M
3300025070|Ga0208667_1010213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2171Open in IMG/M
3300025070|Ga0208667_1073041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300025671|Ga0208898_1158683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300027251|Ga0208809_1010927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1757Open in IMG/M
3300027686|Ga0209071_1183900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater59.48%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.66%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.62%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.03%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.72%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.86%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.86%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.86%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.86%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.86%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.86%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300004278Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150mEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009537Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - D-2WEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300014959Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubationEnvironmentalOpen in IMG/M
3300014973Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubationEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI20151J14362_1021959913300001346Pelagic MarineNTGRPVNKKSARQIRLAKQAFYSNVNDKFVSGNKFEINKSTYKYSAGKDGKLGCIVDTFVGSHVCNVDYIGRTKVKGYTFVLGKKVNVELNLKTLKFSKFVS*
JGI24006J15134_1005050813300001450MarineNKKSARYKRLAKQAFYNDVNSKFKKENQFQVSNSVYNYSQPGEHSEYGCIVDGITGMHVCNVSYIGRTKVQGFTYVLGKRVNVELNLKTLKFVS*
Ga0066609_1013437713300004278MarineRTLNTGRPVNKKSARQARLAKQAFYSNVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKIELNLKTLEFVS*
Ga0075466_115489013300006029AqueousLAKQAFYSNVNDKFVSGNPFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKIELNLKTLEFVS*
Ga0075441_1012193013300006164MarinePVNKKSNRQIRLNKQAHYANVNNMFVSGNAFKINNETYTYTNKSHANEYGIIKSNVTGYVCNVDYIGRTKVKGFTFVLGKMVKVELNLKTLKFVS*
Ga0070744_1012287413300006484EstuarineRLNNTGRPVNKKSARQVRLAKQAFYASVNEKFISGNTFKVSNGEYKYSVGKNGGGCIYNTVTGYVCNVEYVGRTKVKGYTFVLGKKVNVELNLKTLEFVS*
Ga0098038_108050433300006735MarineDGRTNNTGRPVNKKSARQARLAKQAFYADVNDKFQKGNHFKINNTIYKYQASEKGDLGCIVDSVTGFYQLNVSYIGRTKVQGYTFVLGKRVNVELNLKTLKFVK*
Ga0098037_121625213300006737MarinePVNKKSARQARLAKQAFYANVNEKFKSGSTFKVSNSTYKYSVGNNNELGCIIDTFTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK*
Ga0070749_1054770113300006802AqueousRPVNKKSNRQARLAKQAFYNDVNNKFVSGVKFKTKVTSGSTYKYSAGDNGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKQVKIELDLKTLKFVE*
Ga0075477_1029421313300006869AqueousNKFVSGVKFKIKVTSGSTYKYMASKDGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKKVNIELDLKTLKFVS*
Ga0075475_1004346573300006874AqueousRTNNTGRPVNKKSNRQARLAKQAFYNDVNNKFVSGVKFKTKVTSGSTYKYSAGDNGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKQVKIELDLKTLKFVE*
Ga0070746_1030233733300006919AqueousFYNDVNNKFVSGVKFKTKVTSGSTYKYMASKDGELGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKKVNIELDLKTLKFVK*
Ga0070748_130695123300006920AqueousVNKKSARQARLAKQAFYNDVNNKFVSGVKFKASNYSSSIYKYMASKDGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKKVNIELDLKTLKFVK*
Ga0099849_132860213300007539AqueousAKQAFYNDVNNKFVSGVKFKMKVTSGSTYKYMASKDGDLGCIVDGVTHFHECNVSYLGRTKVQGYTFVMGKKVNIELDLKTLKFVK*
Ga0102910_109634413300007667EstuarineDKRTLNTGRPVNKKSARQARLAKQAFYSNVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKIELNLKTLEFVS*
Ga0115555_139996513300009476Pelagic MarineNNTGRPVNKKSARQVRLAKQAFYSNVNDKFVSGNPFKVSNSEYKYSASKNGGCIYNTVTGYVCNVEYVGRTKVKGYTFVLGKKVNVELNLKTLEFVS*
Ga0129283_1012634513300009537Beach Aquifer PorewaterTPYNDVNNKFVSGVKFKTKVTSGSTYKYMASKDGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKQVKIELDLKTLKFVE*
Ga0098049_124026513300010149MarineSARQARLAKQAFYANVNDKFQKGNHFKYNNTTYKYQASGDGRDLGCIVDSVTGFYQCNVSYVGRTKVKGFTFVLGKRVNVELDLKTLKFVR*
Ga0129348_112580423300010296Freshwater To Marine Saline GradientKQAFYADVNDKFLKGNHFKYNNTIYKYHAGKDGDLGCIVDGVSGFHQCNVSYIGRTKVQGYTFVMGKRVSIELNLKTLKFVE*
Ga0160423_1084316513300012920Surface SeawaterNKKSARQVRLAKQAFYADVNAKFKKGNQFEVNGSVYEYQADKNGKSGNGSTLGCIVNEINMHVCNVSYIGRTKVEGYTFVMGKRVNVELNLKTLKFVK*
Ga0134299_105869013300014959MarineNKKSNRQARLAKQAFYNDVNNKFQKGNQFRYNNALYKYVADENGGLGHIVTVGIIDMHACNVSYIGRTKVKGYTFVMGKKMNVELNLKTLKFVK*
Ga0134293_104541513300014973MarineLNTGRPVNKKSARQIRLNKQAFYASVNEKFVTGNPFTLKGQTEQYTYKGTAGKCGIIKSTVTGYVCNVEYIGRTKVQGFTFVLGKQVKIELNLKTLEFVS*
Ga0181371_104333013300017704MarineDKRTSNPGRPVNKQSARYKRLAKQAFYADVNSKFVKGNQFKVNASTYKYSAGDNNELGCIVNDVTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181371_107827513300017704MarineLRLNKQAFYADVNAKFKQGSQFKLNNNTYQYTEHKANELGCIVDTTTGYVCNVSYIGRTKVQGFTFVLGKKVNVELNLKTLKFVS
Ga0181372_102427323300017705MarineYNGDNKFVTRLNTTGRPVTKKSARQLRLNKQAFYANVNAKFKQGNQFKLNNNTYQYTEHNNNELGCIVDTTTGYVCNVSYIGRTKVQGFTFVLGKKVNVELNLKTLKFVS
Ga0181372_106493013300017705MarineTGRPVNKKSARQVRLNKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKDGKLGCIVDTFTGHVCNVSYIGRTKVQGYSFVLGKQVKVELNLKTLKFVS
Ga0181372_107019613300017705MarineRLNNTGRPVNKKSNRQKRLAKQAFYSNVNAKFKQGNQFQVGNDVYKYSPGKNGGCIYNDVTGYVCNIEYVGRTKVKGYTFVLGKKVNVELNLKTLQFVS
Ga0181372_107436213300017705MarineNKKSARQARLAKQAFYADVNDKFKKGNHFKYNNTIYKYQADKNGDLGCIVDSVTGFYQLNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0181377_101921213300017706MarineKQSARYKRLAKQAFYADVNSKFQKGNQFKINNSTYAYSAGKDGSLGCIVDGLGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181387_103595313300017709SeawaterVEVQVEKKVDNRANNTGRPVNKKSARQVRLAKQAFYSNVNGKFKKGNQFKINNSEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKRVNVELNLKTLQFVK
Ga0181387_113888213300017709SeawaterNPGRPVNKKSARYKRLQKQAFYASVNSKFKKGNQFKLSNTDTETYTYKPTDNGLGCILSTVTGYVCNVSYVGRTKVQAYSFTLGKKVNVELNLKTLKFVK
Ga0181403_113609013300017710SeawaterTGRPVNKKSARQIRLNKQAFYSNVNDKFISGKSFKVSNTTYKYSVGKNNTLGCIVNDIQGHVCNVDYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK
Ga0181391_114008613300017713SeawaterNTGRPVNKKSNRQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDSGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVELNLKTLEFVK
Ga0181412_107556613300017714SeawaterGRPVNKKSARQVRLAKQAHYANVNDKFVSGNEFKVGNDVYTYSAGKSGGCIISKTTGYVCNVDYIGRTKVKGFTFVLGKKVNVELNLKTLKFVS
Ga0181404_102788513300017717SeawaterNKKSARQIRLNKQAFYANVNSKFKQGSQFKLNNNTYQYTEHNNNELGCIVDTITGYVCNVSYIGRTKVQGFTFVLGKKVNVELNLKTLKFVK
Ga0181383_104818023300017720SeawaterLAKQAFYSNVNDKFKSGSTFKVSNGEYKYSQPNEHSEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKRVNVELNLKTLQFVK
Ga0181383_109196613300017720SeawaterRYKRLQKQAFYADVNSKFVKGSQFKINNDIYSYKQLPSGKLGCIVNSITGYACNVEYIGRTKVKCYSFVLGKQVKVELNLKTLQFVS
Ga0181373_101640813300017721MarineKSARYKRLAKQAFYNDVNSKFVSGNKFKIHASTYSYSAGKNNELGCIVDSIGMHVCNVDYIGRTKVQGYTFVLGKKVNIELNLKTLKFVS
Ga0181373_106538313300017721MarineKKSARQVRLNKQAHYANVNDKFVKGNQFKVYNSTYKYSAGKDGELGCIVDGIGSHECNVSYIGRTKVQGYKFVLGKKVNVELNLKTLKFVK
Ga0181373_107192113300017721MarineKQAFYADVNSKFVKGSQFKINNDIYSYKQLPSGKLGCIVNSITGYACNVEYIGRTKVKCYSFVLGKQVKVELNLKTLQFVK
Ga0181373_108301313300017721MarineKKSARQVRLNKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKDGSLGCIVDTFTGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181388_105268013300017724SeawaterNKKSARQVRLAKQAFYSNVNDKFKSGSTFKVSNGEYKYSQPNEHSEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKRVNVELNLKTLQFVK
Ga0181401_116072013300017727SeawaterVNNTGRPVNKKSNRQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDSGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVELNLKTLEFVK
Ga0181419_105781013300017728SeawaterTNNTGRPVNKKSARQARLAKQAFYANVNDKFQKGNHFKINNTTYKYQSSEKGDLGCIVDSVTGFYQCNVSYVGRTKVKGYTFVLGKRVNVELDLKTLKFVS
Ga0181419_117581513300017728SeawaterKQAFYNDVNNKFVSGQSFKVNNITYAYESSDNGGGIFDVFTGSYVCNVEYVGRTKVKGYTFVLGKKVNVELNLKTLEFVS
Ga0181396_106714313300017729SeawaterAFYSNVNDKFVSGQSFKVNNITYAYESSDNGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLDKRVNVELNLKTLQFVK
Ga0181396_108238413300017729SeawaterLNTGRPVNKKSARQVRLNKQAFYSNVNNKFQKGNQFKVNGSTYKYSAGDNNELGCIVNDISGHVCNVSYIGRTKVQGYTFVLGKKVNIELNLKTLQFIK
Ga0181396_111379213300017729SeawaterVDNRANNTGRPVNKKSNRQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDSGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVELNLKTLEFVK
Ga0181417_116725813300017730SeawaterRPVNKKSNRQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDSGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVELNLKTLEFVK
Ga0181416_102398213300017731SeawaterRPVNKKSARQKRLAKQAFYADVNRKFKEGNKFEINNTTYKYSAGKDGKLGCIVDTFVGSHVCNVDYIGRTKVQGYTFVLGKKVNVELNLKTLQFNKFVS
Ga0181416_105932113300017731SeawaterPVNKKSARQARLAKQAFYNDVNNKFVSGNEFKVNNITYAYESSDNGGCIFDVFTGSYVCNVEYVGRTKVKGFTYVLGKKVNVELDLKTLKFVE
Ga0181416_114727613300017731SeawaterARQVRLNKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKNNELGCIVDTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0181416_118705413300017731SeawaterKSARQVRLNKQAFYANVNAKFKQGNQFKINNDVYQYTEHNNNELGCIVNTTTGYVCNISYIGRTKVQGFTFVLGKKVNVELNLKTLKFVS
Ga0187218_115127013300017737SeawaterNTGRPVNKKSNRQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDNGGCIFDVFTGSYVCNVDYIGRTKVTGFTYVLGKKVNVELNLKTLEFVS
Ga0181428_101672713300017738SeawaterRNERKINKKSARQARLAKQAFYANVNEKFKTGSMFKLNNDVYQYTENKSGGCIINTTTGYVCNIDYIGRTKVKGYTFVLGKKVNVELNLKTLQFSNFVS
Ga0181428_111101513300017738SeawaterNKKSARQARLAKQAHYANVNDKFVKGNQFKIGSSVYKYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLQFVK
Ga0181433_114954613300017739SeawaterVNKKSARQARLAKQAFYANVNDKFVKGNQFKIKNNTYKYSAGKDGNLGCIVGAEFGIHECNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVR
Ga0181433_115709513300017739SeawaterRPVNKKSNRQQRLAKQAFYSNVNDKFVSGNKFKINNMTYTYSVGDNDGLGCIIDGVFGSHVCNVDYIGRTKVTGYTFVLGKKVNVELNLKTLQFVK
Ga0181418_118109413300017740SeawaterQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDSGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVELNLKTLEFVK
Ga0181399_113050713300017742SeawaterTGRPVNKKSNRQQRLAKQAFYNDVNNKFVSGKHFQRGTSSIYKYSAGDTDGLGCIVETAFGSHVCNVDYIGRTKVTGYTFVLGKRVNVELNLKTLKFVK
Ga0181399_113519213300017742SeawaterRPVNKKSARQIRLNKQAFYSNVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCYTFVLGKQVKVELNLKTLEFVS
Ga0181402_105258223300017743SeawaterRPVNKKSARQVRLNKQAFYSNVNSKFVKGNQFKIGGSVYKYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181427_101640443300017745SeawaterSARQARLAKQAFYADVNAKFKKGNQFKVTNGTYAYEASDNGGCILDVFTGAYVCNVSYIGRTKVQGFTYVLGKKVNVELNLKTLKFVK
Ga0181427_103973913300017745SeawaterYADVNNKFVSGVNFKLNNIEYKYHAGKDGDLGCIVDGVTHFHQCNVSYIGRTKVQGYTFVMGKRVSIELDLKTLKFVS
Ga0181427_107810513300017745SeawaterPVNKKSARYKRLQKQAFYADVNSKFKKGSQFKVDGSSSKYKYSTTDDKLGCIVETVFGGHVCNISYIGRTKVKGYSFVLGKRVNVELNLKTLQFVK
Ga0181389_119395813300017746SeawaterPVNKKSARQARLAKQAFYADVNSKFKSGNLFEINNSTYQYSEGSENVNSGCIVNSVTGHVCNVDYIGRTKVKGYTFVLGKKVNVELNLKTLKFVS
Ga0181393_100930013300017748SeawaterLAKQAFYADVNAKFVSGKSFKVTNGTYAYEASDNGGCILDVFTGAYVCNVSYIGRTKVQGFTYVLGKKVNVELDLKTLQFVK
Ga0181392_121458713300017749SeawaterTGRPVNKKSARQKRLNKQAFYANVNDKFVSGNKFEINKSTYKYSAGKDGKLGCIVNSITGHVCNVSYLGRTKVQGYTFVLGKKVNVELNLKTLQFVK
Ga0181400_103570213300017752SeawaterNNTGRPVNKQSARYKRLAKQAFYADVNSKFQKGNQFKINNSTYAYSAGKDGSLGCIVDGLGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181407_109052413300017753SeawaterVNKKSARQTRLAKQAFNNDVNNKFVSGQSFKVNNLTYAYESSDNGGCIFDVFTGSYVCNVDYIGRTKVTGFTYVLGKKVNVELNLKTLEFVS
Ga0181420_100896213300017757SeawaterQAHYANVNDKFVKGNQFKIGSSVYKYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLQFVK
Ga0181420_106653313300017757SeawaterKNNPGRPVNKKSARYKRLAKQAFYASVNSKFVKGNQFKLSNTDTETYTYKPSDNGLGCILSTVTGYVCNVSYIGRTKVQAFTFVLGKQVKVELNLKTIKFVS
Ga0181420_119622813300017757SeawaterKSARQARLAKQAFYNDVNNKFVSGNEFKMKVTSSNTYKYLANEKGGLGCIVDGVTHFHECNVSYIGRTKVQGYTFVMGKKVTIELNLKTLKFVK
Ga0181420_123262913300017757SeawaterNRVNNTGRPVNKKSARQARLAKQAFYASVNEKFVSGNAFTLKGQTEQYTYKATAGKCGIIKSVVTGYVCNVEYVGRTKVKGYTFVLGKQVNVELNLKTLNFVS
Ga0181409_113661713300017758SeawaterNRLNNTGRPVNKKSNRQKRLAKQAFYADVNRKFKEGNKFEINKSTYKYSAGKDGKLGCIVDTFVGSHVCNVDYIGRTKVQGYSFVLGKKVNVELNLKTLQFSKFVS
Ga0181409_122787613300017758SeawaterGRPVNKKSNRQQRLAKQAFYNDVNNKFVSGQSFKVNNITYAYESSDSGGCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVELNLKTLEFVK
Ga0181414_1000156323300017759SeawaterVNKKSARQVRLAKQAFYANVNGKFKKGNQFKINNSEYKYSQPNEHSEYGCIVNNISGHVCNVSYIGRTKVEGYTFVLGKRVNVELNLKTLEFVK
Ga0181408_101518873300017760SeawaterKNNPGRPVNKKSARYKRLAKQAFYADVNSKFKTGNLFKVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTFTLGKKVNIELNLKTLKFVS
Ga0181408_109703013300017760SeawaterNTGRPVNKKSARYKRLQKQAFYADVNNKFVKGNQFKVYNSTYKYSAGKDGSLGCIVDGIGSHECNVSYIGRTKVQGYKFVLGKKVNIELDLKTLKFVK
Ga0181422_111619313300017762SeawaterKQAHYANVNDKFVKGNQFKIGSSVYKYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLQFVK
Ga0181385_103774613300017764SeawaterKSARQIRLNKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKNNELGCIVDTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVK
Ga0181385_104296413300017764SeawaterKRTLNTGRPVNKKSARQIRLNKQAFYANVNDKFVKGNQFKVNNSTYNYSAGKDNTLGCIVDIFTGSHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181385_108761313300017764SeawaterSNRQKRLAKQAFYANVNDKFVSGNKFEINNTTYKYSAGKDGKLGCIEDTFVGSHVCNVDYIGRTKVKGYTFVLGKKVNVELNLKTLQFSKFVS
Ga0181385_111842213300017764SeawaterRLNKQAFYANVNSKFKQGSQFKLNNNTYQYTEHNNNELGCIVDTITGYVCNVSYIGRTKVQGFTFVLGKKVNVELNLKTLKFVK
Ga0181385_118077323300017764SeawaterVNKKSARQKRLNKQAFYANVNDKFVSGKSFKIGNDVYTYEPSFNNTLGSIVSNVTGYVCNVSYIGRTKVQGFTFVLGKQVKIELNLKTLKFVS
Ga0181413_113780413300017765SeawaterKSNRQKRLAKQGFYANVNDKFVSGNKFEINNTTYKYREGKDGKLGCIVDTFVGSHVCNVDYIGRTKVKGYTFVLGKKVNVELNLKTLQFSKFVS
Ga0181413_118350013300017765SeawaterRQARLAKQAFYANVNDKFVSGAKFKIKNNTYKYSAGKDGNLGCIVGAEFGIHECNVSYIGRTKVQGYTFVLGKKVNIELNLKTLKFVR
Ga0187217_119881913300017770SeawaterRLAKQALYASLNDKFKSGSTFKVSNSEYNYSQPNNNNEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLQFVS
Ga0181425_109758423300017771SeawaterNNTGRPVNKKSARQIRLNKQAFYSNVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCYTFVLGKQVKVELNLKTLEFVS
Ga0181425_119224713300017771SeawaterRPVNKKSARYKRLAKQAFYSNVNDKFQKGNQFKIGSSVYSYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLKFVS
Ga0181430_108590213300017772SeawaterRLNNTGRPVNKKSARQARLAKQAFYADVNAKFKKGNQFKVTNGTYAYEASDNGGCILDVFTGAYVCNVSYIGRTKVQGFTYVLGKKVNVELNLKTLKFVK
Ga0181430_109834413300017772SeawaterNNTGRPINKKSARQARLAKQAFYASVNEKFISGNTFKVSNSEYKYSVGKNGGGCIYNTVTGYVCNVEYVGRTKVKGYTFVLGKKVNVELNLKTLEFVS
Ga0181430_118786613300017772SeawaterARQVRLAKQALYASLNDKFKSGSTFKVSNGEYKYSQPNEHSEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLKFVS
Ga0181432_130819313300017775SeawaterGLAKQAFYADVNSKFKTGNLFKVSGSTYYYSEGSENKNNGCIVDGVTNMHVCNVDYIGRTKVQGYTFTLGKKVNIELNLKTLKFVS
Ga0181394_104119613300017776SeawaterNNTGRPVNKKSARQVRLNKQAFYSNVNDKFVSGNAFKVGNEIYKFSAGKTLGCIVSNVTGYVCNVDYIGRTKVKCYSFVLGKKVNVELNLKTLQFVK
Ga0181423_111859713300017781SeawaterNKKSARQIRLNKQAHYASLNDKFVSGNPFKVKNDVYQYTEHNNNELGCIVNTTTGYVCNISYIGRTKVQGFTFVLGKKVNVELNLKTLKFVS
Ga0181423_116191313300017781SeawaterLNNTGRPVNKKSNRQKRLAKQAFYSNVNDKFKSGSTFKVSNGEYKYSQPNEHSEYGCIVNNISGHVCNVSYIGRTKVQGYTFVLGKRVNVELNLKTLQFVK
Ga0181423_128458113300017781SeawaterRLAKQAFYSNVNDKFQKGNQFKIGSSVYSYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNIELNLKTLKFVS
Ga0181380_129239013300017782SeawaterGRPVNKKSARQARLAKQAHYANVNDKFVKGNQFKIGSSVYKYSAGKNNELGCIVDSIGLHQCNVDYIGRTKVKCYSFTLGKKVNVELNLKTLQFVK
Ga0181379_102824613300017783SeawaterNNTGRPVNKKSARQVRLAKQAHYNNVNTLFVTGNAFKIGNNEYTYKQLPSGKLGCIVDNVTGYVCNVSYIGRTKVQGFTFVLGKQVKVELNLKTLKFVS
Ga0181379_115100813300017783SeawaterRPVNKKSARQVRLAKQAHYANVNDKFVSGNKFEINNMTYKYSAGKDGKLGCIVDTFVGSHVCNVDYIGRTKVKGYSFVLGKKVNIELNLKTLKFSKFVS
Ga0181424_1014388713300017786SeawaterKETKIDGRTNNTGRPVNKKSARQARLAKQAFYADVNNKFVSGVNFKLNNIEYKYHAGKDGDLGCIVDGVTHFHQCNVSYIGRTKVQGYTFVMGKRVSIELDLKTLKFVS
Ga0206125_1023216513300020165SeawaterDNRLNNTGRPVNKKSNRQQRLAKQAFYADVNTKFKKGNQFKVNNSTYKYSAGKDGKLGCIVDTFVGSHVCNVDYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK
Ga0211678_1002600273300020388MarineRLAKQAFYADVHNKFVSGQSFKVNNITYAYESSDSGSCIFDVFTGSYVCNVEYVGRTKVTGFTYVLGKKVNVTLNLKTLEFVK
Ga0211678_1036789313300020388MarineGRPVNKKSARQIRLAKQAHYTNLNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKVELNLKTLEFVS
Ga0211651_1040088813300020408MarineNKKSARQARLAKQAFYADVNAKFVSGNAFKIKSNTYKYSAGKNGALGCIVGAEFGIHECNVSYIGRTKVKGYTFVLGKKVNVELDLKTLKFVR
Ga0211543_1050915813300020470MarineVKVDGRKNNTGRPVNKKSARQARLAKQAFYADVNSKFKKGNQFKYNNALYKYVAGKNGELGYISTVGIVTQHACNVSYIGRTKVQGYTFVLGKRVNIELNLKTLKFVK
Ga0212023_105059513300022061AqueousLAKQAFYNDVNNKFVSGVKFKIKVTSGSTYKYMASKDGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKKVNIELDLKTLKFVS
Ga0212022_100596143300022164AqueousRQIRLAKQAFYSNVNDKFVSGNVFKVSNSEYKYSASKNGGCIYNTVTGYVCNVEYVGRTKVKGYTFVLGKKVNVELNLKTLEFVS
(restricted) Ga0233432_1049957313300023109SeawaterRPVNKKSARQIRLAKQRHYANVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKIELNLKTLEFVS
Ga0244776_1015092313300024348EstuarineVNKKSARQARLAKQAFYSNVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKIELNLKTLEFVS
Ga0208667_101021313300025070MarineRTNNTGRPVNKKSARQARLAKQAFYANVNDKFQKGNHFKYNNTTYKYQASGDGRDLGCIVDSVTGFYQCNVSYVGRTKVKGFTFVLGKRVNVELDLKTLKFVE
Ga0208667_107304113300025070MarineGRPVNKKSARYIRLQKQAFYADVNAKFKQGNQFKVNNSTYNYSAGKNNELGCIVDTITGHVCNVSYIGRTKVQGYTFVLGKKVNVELNLKTLQFVK
Ga0208898_115868313300025671AqueousNNTGRPVNKKSNRQARLAKQAFYNDVNNKFVSGVKFKIKVTSGSTYKYMASKDGDLGCIVDGVTHFHECNVSYIGRTKVKGYTFVMGKQVKIELDLKTLKFVE
Ga0208809_101092713300027251EstuarineLAKQAFYSNVNDKFVSGNAFKVKNDVYTYSASKNGGCIVSKTTGYVCNVEYVGRTKVKCFTFVLGKQVKIELNLKTLEFVS
Ga0209071_118390013300027686MarineKRTLNTGRPVNKKSARQVRLNKQALYASLNDKFVTGNAFKIGNETYTYNARPDGGLGSIGSKVTGYVCNVEYIGRTKVQGFTFVLGKQVKIELNLKTLNFVS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.