NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F079061

Metagenome / Metatranscriptome Family F079061

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079061
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 38 residues
Representative Sequence DTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLG
Number of Associated Samples 97
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.72 %
% of genes near scaffold ends (potentially truncated) 96.55 %
% of genes from short scaffolds (< 2000 bps) 83.62 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.552 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(28.448 % of family members)
Environment Ontology (ENVO) Unclassified
(32.759 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.724 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.08%    β-sheet: 3.08%    Coil/Unstructured: 73.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF04041Glyco_hydro_130 13.79
PF07702UTRA 4.31
PF08282Hydrolase_3 4.31
PF00672HAMP 3.45
PF06764DUF1223 2.59
PF13620CarboxypepD_reg 2.59
PF02321OEP 1.72
PF09424YqeY 1.72
PF05199GMC_oxred_C 1.72
PF02566OsmC 1.72
PF04011LemA 1.72
PF01842ACT 0.86
PF08245Mur_ligase_M 0.86
PF14559TPR_19 0.86
PF13518HTH_28 0.86
PF04932Wzy_C 0.86
PF00589Phage_integrase 0.86
PF06271RDD 0.86
PF09650PHA_gran_rgn 0.86
PF13450NAD_binding_8 0.86
PF13442Cytochrome_CBB3 0.86
PF02702KdpD 0.86
PF00171Aldedh 0.86
PF01935DUF87 0.86
PF16657Malt_amylase_C 0.86
PF13473Cupredoxin_1 0.86
PF02836Glyco_hydro_2_C 0.86
PF00665rve 0.86
PF00535Glycos_transf_2 0.86
PF09933DUF2165 0.86
PF17189Glyco_hydro_30C 0.86
PF04138GtrA 0.86
PF08281Sigma70_r4_2 0.86
PF00175NAD_binding_1 0.86
PF01364Peptidase_C25 0.86
PF01979Amidohydro_1 0.86
PF01564Spermine_synth 0.86
PF13432TPR_16 0.86
PF00582Usp 0.86
PF13421Band_7_1 0.86
PF02585PIG-L 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG2152Predicted glycosyl hydrolase, GH43/DUF377 familyCarbohydrate transport and metabolism [G] 13.79
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 4.31
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 4.31
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 4.31
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 4.31
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 4.31
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 3.45
COG5429Uncharacterized conserved protein, DUF1223 domainFunction unknown [S] 2.59
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 1.72
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 1.72
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 1.72
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 1.72
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.86
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.86
COG2205K+-sensing histidine kinase KdpDSignal transduction mechanisms [T] 0.86
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.86
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.86
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.86
COG3307O-antigen ligaseCell wall/membrane/envelope biogenesis [M] 0.86
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.86
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.86
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.86
COG4584TransposaseMobilome: prophages, transposons [X] 0.86
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.55 %
UnclassifiedrootN/A3.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16814961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2439Open in IMG/M
3300001154|JGI12636J13339_1000292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8267Open in IMG/M
3300001867|JGI12627J18819_10402372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis557Open in IMG/M
3300001867|JGI12627J18819_10499268All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300002917|JGI25616J43925_10270518All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300004082|Ga0062384_101370741All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300004092|Ga0062389_101734682All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300005332|Ga0066388_101933528All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1055Open in IMG/M
3300005456|Ga0070678_100156369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1842Open in IMG/M
3300005556|Ga0066707_10276538All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300005566|Ga0066693_10138654All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005575|Ga0066702_10907412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae526Open in IMG/M
3300005764|Ga0066903_101407804All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1310Open in IMG/M
3300005921|Ga0070766_10152529All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300006174|Ga0075014_100384815All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300006237|Ga0097621_100577955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1025Open in IMG/M
3300006804|Ga0079221_10758144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae687Open in IMG/M
3300007258|Ga0099793_10136548Not Available1156Open in IMG/M
3300007265|Ga0099794_10812459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300009088|Ga0099830_10322359All Organisms → cellular organisms → Bacteria → Acidobacteria1237Open in IMG/M
3300009090|Ga0099827_10165053All Organisms → cellular organisms → Bacteria → Acidobacteria1822Open in IMG/M
3300009143|Ga0099792_10364912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300010304|Ga0134088_10140937All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300010335|Ga0134063_10039178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2041Open in IMG/M
3300010358|Ga0126370_12425865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter521Open in IMG/M
3300010359|Ga0126376_11248063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300010360|Ga0126372_10162894All Organisms → cellular organisms → Bacteria1803Open in IMG/M
3300010361|Ga0126378_12348393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300010361|Ga0126378_13427425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300010366|Ga0126379_13758863Not Available509Open in IMG/M
3300010398|Ga0126383_10167528All Organisms → cellular organisms → Bacteria2071Open in IMG/M
3300010398|Ga0126383_12339996All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300010403|Ga0134123_12979824All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300011120|Ga0150983_12608239All Organisms → cellular organisms → Bacteria2112Open in IMG/M
3300011270|Ga0137391_10050737All Organisms → cellular organisms → Bacteria3536Open in IMG/M
3300011270|Ga0137391_10097720All Organisms → cellular organisms → Bacteria → Acidobacteria2542Open in IMG/M
3300011271|Ga0137393_11095121All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300011271|Ga0137393_11801698All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012189|Ga0137388_11748392All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300012189|Ga0137388_11852182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300012201|Ga0137365_10021790All Organisms → cellular organisms → Bacteria4972Open in IMG/M
3300012203|Ga0137399_10139629All Organisms → cellular organisms → Bacteria1924Open in IMG/M
3300012203|Ga0137399_11442254All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300012209|Ga0137379_10064643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis3521Open in IMG/M
3300012211|Ga0137377_10894263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300012285|Ga0137370_10339824All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300012285|Ga0137370_10740190All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300012361|Ga0137360_10724017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300012582|Ga0137358_10050562All Organisms → cellular organisms → Bacteria2768Open in IMG/M
3300012901|Ga0157288_10419445All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012917|Ga0137395_10518861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
3300012918|Ga0137396_10122654All Organisms → cellular organisms → Bacteria1874Open in IMG/M
3300012925|Ga0137419_10297182All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300012925|Ga0137419_10490628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium974Open in IMG/M
3300012925|Ga0137419_11183180All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012925|Ga0137419_11274975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300012927|Ga0137416_11620075All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012930|Ga0137407_10022560All Organisms → cellular organisms → Bacteria4760Open in IMG/M
3300012957|Ga0164303_10218371All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300014200|Ga0181526_10135652All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300015052|Ga0137411_1188471All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300017792|Ga0163161_11614293All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300017941|Ga0187850_10165080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1031Open in IMG/M
3300017972|Ga0187781_10200917All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300017973|Ga0187780_11023555All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300018085|Ga0187772_11340904All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300020018|Ga0193721_1174564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus502Open in IMG/M
3300020199|Ga0179592_10067325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → Rubricoccaceae → Rubrivirga → Rubrivirga marina1637Open in IMG/M
3300020580|Ga0210403_10179652All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300020581|Ga0210399_11025118All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300020581|Ga0210399_11077781All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300020583|Ga0210401_11368025All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300021086|Ga0179596_10422997All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300021088|Ga0210404_10591365All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300021168|Ga0210406_10127236All Organisms → cellular organisms → Bacteria → Acidobacteria2150Open in IMG/M
3300021170|Ga0210400_10704946All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300021171|Ga0210405_10627020All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300021171|Ga0210405_11114041All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300021432|Ga0210384_10001403All Organisms → cellular organisms → Bacteria32905Open in IMG/M
3300021479|Ga0210410_10798449All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300021479|Ga0210410_10963115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300021560|Ga0126371_10107728Not Available2788Open in IMG/M
3300024330|Ga0137417_1497071All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300026285|Ga0209438_1052198All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300026315|Ga0209686_1045729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1618Open in IMG/M
3300026318|Ga0209471_1189821All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300026320|Ga0209131_1203322All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300026334|Ga0209377_1068442All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300026342|Ga0209057_1250137All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300026467|Ga0257154_1082250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300027591|Ga0209733_1043651All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300027616|Ga0209106_1047565All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300027629|Ga0209422_1053251All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300027651|Ga0209217_1040245All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300027768|Ga0209772_10268653All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027862|Ga0209701_10019538All Organisms → cellular organisms → Bacteria → Acidobacteria4415Open in IMG/M
3300028047|Ga0209526_10041048All Organisms → cellular organisms → Bacteria3256Open in IMG/M
3300028047|Ga0209526_10138708All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300029636|Ga0222749_10508326All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium653Open in IMG/M
3300031057|Ga0170834_107159917All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031446|Ga0170820_12358571All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031474|Ga0170818_112761310All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300031754|Ga0307475_10108541All Organisms → cellular organisms → Bacteria → Acidobacteria2174Open in IMG/M
3300031754|Ga0307475_10446029All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300031754|Ga0307475_11339482All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300031781|Ga0318547_10901115All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031820|Ga0307473_10252746All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300031833|Ga0310917_10973839All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300031946|Ga0310910_10040246All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3240Open in IMG/M
3300031946|Ga0310910_10722978All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium786Open in IMG/M
3300031954|Ga0306926_12308022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300032060|Ga0318505_10123836All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300032180|Ga0307471_100868425All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300032180|Ga0307471_102217929All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300032805|Ga0335078_11694774All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300033004|Ga0335084_12287195Not Available522Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil28.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.38%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.03%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.86%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.86%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026467Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-AEnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_024278102088090014SoilLIDTEGQKAIDVFYLTSQGRKLDSRKRDVLREVLQGTLG
JGI12636J13339_100029213300001154Forest SoilIDTEGQKAIDVFYLTEQGNKLNAQKKSLLQEVLQGTLA*
JGI12627J18819_1040237223300001867Forest SoilDTEGQKAIDVFYLTSQGNKLDSRKQDVLREVLQGTLG*
JGI12627J18819_1049926813300001867Forest SoilIDTEGQKAIDVFYLTSRGKKLEPQKQEVLREVLQGTLG*
JGI25616J43925_1027051813300002917Grasslands SoilLIDTEGQKAIDVFYLTAQGGKLTLQKKELLREVLEATLG*
Ga0062384_10137074113300004082Bog Forest SoilLIDTEGQKAIDVFYLTEQGKKLSPEKQEALLKALHEKLG*
Ga0062389_10173468213300004092Bog Forest SoilLIDTEGQKAIDVFYLTEQGKKLSPEKQEALLQALHEKLG*
Ga0066388_10193352813300005332Tropical Forest SoilLIDTEGQKAIDVFYLTSHGNKLDSRKQDVLREVLQGTLG*
Ga0070678_10015636913300005456Miscanthus RhizosphereALIDTEGHTAIDVFYLTSGGEKLQAGKQEELRATLTTILK*
Ga0066707_1027653833300005556SoilLIDTEGQKAIDGFYLTSQGKKLAAQKQDLLREVLQGTLG*
Ga0066693_1013865413300005566SoilALIDTEGQKAIDVFYLTEQRHKLSAEKQEALRDALQRALR*
Ga0066702_1090741223300005575SoilGHKAIDVFYLTAQGKKLTGQKQELLREVLQGTLS*
Ga0066903_10140780413300005764Tropical Forest SoilLIDTEGQKAIDVFYLTSQGKKLTAQKQDLLREVLQGTLG*
Ga0070766_1015252923300005921SoilDTEGQKAIDVFYLTEQGEKLSLEKQDALRQALQQKLG*
Ga0075014_10038481523300006174WatershedsTEGQKAIDVFYLTEQGNKLNAQKKNLLHEVLQGTLA*
Ga0097621_10057795523300006237Miscanthus RhizosphereEGQKAIDVFYLTSQSKKLDSRKQEVLREVLQGTLG*
Ga0079221_1075814413300006804Agricultural SoilGHKAIDVFYLTAQGKKLTEQKQELLREVLQGTLS*
Ga0099793_1013654823300007258Vadose Zone SoilALIDTEGQKAIDVFYLTTQGQKLPPQKQELLRELLQGTLG*
Ga0099794_1081245923300007265Vadose Zone SoilIDTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV*
Ga0099830_1032235913300009088Vadose Zone SoilEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLG*
Ga0099827_1016505313300009090Vadose Zone SoilTEGHKAIDVFYLTGQGKKLTTQQQELLREVLQGTLI*
Ga0099792_1036491223300009143Vadose Zone SoilLIDTEGQKAIDVFYLTSRGKKLEPQKQEMLREVLQGTLG*
Ga0134088_1014093713300010304Grasslands SoilEGQKAIDVFYLTSRGKKLDVQKRDVLREVLQGTIG*
Ga0134063_1003917813300010335Grasslands SoilDTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLG*
Ga0126370_1242586513300010358Tropical Forest SoilEGQKVIDVFYLTEQGKKLGAEKQAALFEALRSKLG*
Ga0126376_1124806333300010359Tropical Forest SoilGQKAIDVFYLTEDGKKLSASKQQMLRDALQGTLG*
Ga0126372_1016289453300010360Tropical Forest SoilDTEGQKAIDVFYLTSHGNKLDSRKQDVLREVLQGTLG*
Ga0126378_1234839313300010361Tropical Forest SoilTEGHKAIDVFYLTAQGRKLTAQKQELLREVLQGTLS*
Ga0126378_1342742523300010361Tropical Forest SoilTEGQKAIDVFYLTEDGKKLSASKQQMLRDALQGTLG*
Ga0126379_1375886323300010366Tropical Forest SoilDTEGHKAIDVFYLTAQGKKLTAQKQELLREVLHGTLG*
Ga0126383_1016752813300010398Tropical Forest SoilLIDTEGQKAIDVFYLTSQGNKLDPRKQDVLREVLHGTLA*
Ga0126383_1233999613300010398Tropical Forest SoilTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLS*
Ga0134123_1297982413300010403Terrestrial SoilALIDTEGHTAIDVFYLTSGGEKLKAGKQEELRATLTTILK*
Ga0150983_1260823913300011120Forest SoilIDTEGQKAIDVFYLTERGKKLSQQKQELLREVLESTLS*
Ga0137391_1005073753300011270Vadose Zone SoilLIDTEGQKAIDVFYITAQGKKLPTQKQELLREVLQG
Ga0137391_1009772013300011270Vadose Zone SoilGQKAIDVFYLTEQGKKLTSQKQELLREALQGTLG*
Ga0137393_1109512123300011271Vadose Zone SoilLIDTEGQKAIDVFYLTEQGKKLSSQKQDLLREVLQGTLG*
Ga0137393_1180169813300011271Vadose Zone SoilEGQKAIDVFYLTDQGKKLGAQMKELLREVLQRTLV*
Ga0137388_1174839223300012189Vadose Zone SoilALIDTEGQKAIDVFYLTAQDNKLNAQKKNLLHEVLQGTLP*
Ga0137388_1185218213300012189Vadose Zone SoilGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLS*
Ga0137365_1002179013300012201Vadose Zone SoilIDTEGQKAIDVFYLTEQGKKLTSQKQELLREALQGTLG*
Ga0137399_1013962913300012203Vadose Zone SoilTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV*
Ga0137399_1144225423300012203Vadose Zone SoilLIDTEGQKAIDVFYLTAQGKKLPPQKQELLREVLQGTLS*
Ga0137379_1006464333300012209Vadose Zone SoilIDTEGHKAIDAFYLTALGEKLTTQKQELLREVLQGTLV*
Ga0137377_1089426323300012211Vadose Zone SoilEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV*
Ga0137370_1033982423300012285Vadose Zone SoilVALIDTEGHKAIDVFYLTAQEKKLTTQKQELLREVLQGTLA*
Ga0137370_1074019023300012285Vadose Zone SoilDTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLA*
Ga0137360_1072401713300012361Vadose Zone SoilTEGHKAIDAFYLTAQGEKLTAQKQELLREVLQGTLV*
Ga0137358_1005056233300012582Vadose Zone SoilDTEGQKAIDVFYLTEHAKKLGTEKQDLLRASLQHALA*
Ga0157288_1041944523300012901SoilRGALLALIDTEGQKAIDVFYLTSQGSKLDSRKQDVLREVLQGTLG*
Ga0137395_1051886123300012917Vadose Zone SoilIDTEGQKAIDVFYLTSRGKKLEPQKQEMLREVLQGTLG*
Ga0137396_1012265413300012918Vadose Zone SoilTEGHKAIDVFYLTAQGKKLTTQKQELLCEVLQGTLV*
Ga0137419_1029718213300012925Vadose Zone SoilTEGEKAIDVFYLTAQGKKLDSRKQEVLQEVLQGTLG*
Ga0137419_1049062823300012925Vadose Zone SoilEGQKAIDVFYLTAQNKKLSAQKQDLLREVLQGMLG*
Ga0137419_1118318023300012925Vadose Zone SoilLIDTEGQKAIDVFYLTAQGGKLTPQKKELLREVLEATLG*
Ga0137419_1127497533300012925Vadose Zone SoilEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLF*
Ga0137416_1162007523300012927Vadose Zone SoilTEGQKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV*
Ga0137407_1002256053300012930Vadose Zone SoilALIDTEGQKAIDVFYLTSRGKKLDAQKREVLREVLQGTIG*
Ga0164303_1021837113300012957SoilALIDTEGQKAIDVFYLTSQSKKLDSRKQEVLREVLQGTLG*
Ga0181526_1013565243300014200BogIDTEGQKAIDVFYLTAQGKKLTTQKQELLREVLMATLT*
Ga0137411_118847123300015052Vadose Zone SoilDTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV*
Ga0163161_1161429313300017792Switchgrass RhizosphereTEGQKVIDVFYLTEQGKKLSLHKQEILRRALQGKLE
Ga0187850_1016508043300017941PeatlandEGQKAIDVFYLTGQGKKLAPQKQELLREVLNATLS
Ga0187781_1020091713300017972Tropical PeatlandLIDTEGHKAIDVFYLTTQGKKLAAQKQELLREVLQGTLA
Ga0187780_1102355523300017973Tropical PeatlandLIDTEGQKAIDVFYLTSQGKKLTSQKKELLREVLQATLS
Ga0187772_1134090413300018085Tropical PeatlandEGQKAIDVFYLTSQGQKLSAQKQVLLREVLQATLS
Ga0193721_117456413300020018SoilIDTEGHKAIDVFYLTAQGKKLTTQKQELLCEVLQGTLV
Ga0179592_1006732523300020199Vadose Zone SoilDTEGHKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV
Ga0210403_1017965213300020580SoilIEGQKAIDVFYLTEQAKKLSAEKQQSLREALQSALG
Ga0210399_1102511823300020581SoilEGQKAIDVFYLTSRGKKLTEQIKESLRQELQRSLN
Ga0210399_1107778123300020581SoilIDTEGQKAIDVFYLTERGEKLSQQKHELLREVLQSTLS
Ga0210401_1136802513300020583SoilDTEGQKAIDVFYLTEQGKKLSPEKQEALLKALHEKLG
Ga0179596_1042299713300021086Vadose Zone SoilEVALIDTEGHKAIDAFYLTALGEKLTTQKQELLREVLQGTLV
Ga0210404_1059136523300021088SoilIDTEGLKAIDVFYLTTQGKKLTSQKQELLREVLQGTLG
Ga0210406_1012723613300021168SoilVALINTEGQKAIDVFYLTAQGKKLTTSKQDLVREVLQGTLG
Ga0210400_1070494623300021170SoilTEGQKVIDVFYLTEQAKKLSAEKQQSLRLALQSALG
Ga0210405_1062702013300021171SoilLIDTEGQKAIDVFYLTEQGKKLSIQKQDLLREVLQGTLG
Ga0210405_1111404113300021171SoilTEGQKAIDVFYLTEQGKKLSAEKQEALRGALQSALG
Ga0210384_10001403133300021432SoilLIDTEGQKAIDVFYLTAQANKLDAQKKNLLHEVLQGTLA
Ga0210410_1079844913300021479SoilDTEGQKAIDVFYLTEQGKKLSAEKQEALRGALQSALG
Ga0210410_1096311513300021479SoilDTEGQKAIDVFYLTEQAKKLSPEKQQSLREALQGALG
Ga0126371_1010772813300021560Tropical Forest SoilLIDTEGHKAIDVFYLTAQSKKLTAQKQELLREVLQGTLS
Ga0137417_149707143300024330Vadose Zone SoilVALIDTEGQKAIDVFYLTEQREKLSTQKQELLREVLQGTLG
Ga0209438_105219823300026285Grasslands SoilLIDTEGQKAIDVFYLTAQGGKLTPQKKELLREVLEATLG
Ga0209686_104572913300026315SoilEGHKAIDVFYLTGQGKKLTTQKQELLREVLQGTLV
Ga0209471_118982123300026318SoilALIDTEGHKAIDVFYLTGQGKKLTTQKQELLREVLQGTLV
Ga0209131_120332223300026320Grasslands SoilTEGQKAIDVFYLTAQGKKLTTQKQELLREVLQGTLV
Ga0209377_106844233300026334SoilIDTEGQKAIDVFYLTSRGKKLDAQKREVLREVLEGTIG
Ga0209057_125013723300026342SoilIDTEGHKAIDVFYLTAQGKKLTAQKQELLREVLQGTLS
Ga0257154_108225023300026467SoilEGQKVIDVFYLTEHGKKLSPETQESLRRALREKLG
Ga0209733_104365113300027591Forest SoilLIDTEGQKVIDVFYLTEQGKKLSAEKQESLRQALNAALV
Ga0209106_104756513300027616Forest SoilEGQKAIDVFYLTSRGKKLTEQIKESLRQELQRSLS
Ga0209422_105325113300027629Forest SoilDTEGQKAIDVFYLTSRGKKLTEKIKDGLRQELQRSLG
Ga0209217_104024533300027651Forest SoilLIDTEGQKAIDVFYLTSRGKKLTDQIKDALRQDLQRSIG
Ga0209772_1026865313300027768Bog Forest SoilEVALIDTEGQKAIDVFYLTSEAKKLSASKQELLREVLKGTLN
Ga0209701_1001953833300027862Vadose Zone SoilDTEGQKAIDVFYLTAQGKKLSPQKQELLREVLQGTLS
Ga0209526_1004104813300028047Forest SoilIDTEGQKAIDVFYLTERAKKLSAEKQQSLCEALQSALR
Ga0209526_1013870823300028047Forest SoilTEGQKAIDVFYLTEHTKKLSAEKQQSLREALQSALG
Ga0222749_1050832613300029636SoilEGQKAIDVFYLTAQGKKLTTQKQELLRAVLQGTLV
Ga0170834_10715991713300031057Forest SoilIDTEGQKVIDVFYLTEQGKKLGPEKQAALFEALRTKLG
Ga0170820_1235857123300031446Forest SoilDTEGQKAIDVFYLTSRGKKLESQKQEILREVLQGTLG
Ga0170818_11276131023300031474Forest SoilDTEGQKAIDVFYLTAQGRKLTPQKQELLREVLLAMLA
Ga0307475_1010854133300031754Hardwood Forest SoilDTEGQKAIDVFYLTSQGKKLEPSKQEVLREVLQGTLG
Ga0307475_1044602913300031754Hardwood Forest SoilLIDTEGQKAIDVFYLTSRGKKLEPQKQEALREVLQGTLG
Ga0307475_1133948213300031754Hardwood Forest SoilLIDTEGQKAIDVFYLTEQSKKLSPEKQNALRQALQQKLG
Ga0318547_1090111513300031781SoilDTEGQKAIDVFYLTTQGRKLTSPKKDLVRDVLQGTLI
Ga0307473_1025274623300031820Hardwood Forest SoilALIDTEGQKAIDVFYLTSRGKKLTEQIKDALRQDLQRSLG
Ga0310917_1097383913300031833SoilIDTEGQKAIDVFYLSAQSRKLTAQKQEVLREVLQATLS
Ga0310910_1004024663300031946SoilTEGQKAIDVFYLTSQGNKLDSRKQDVLREVLQGTLG
Ga0310910_1072297823300031946SoilIDTEGQKAIDVFYLSAQSGKLTAQKQEVLREVLQATLS
Ga0306926_1230802223300031954SoilVALVDTEGQKAIDVFYLTTQGRKLTSPKKDLVRDVLQGTLI
Ga0318505_1012383613300032060SoilALIDTEGQKAIDVFYLTSQGNKLDSRKQDVLREVLQGTLG
Ga0307471_10086842513300032180Hardwood Forest SoilDTEGQKAIDVFYLTEQAKKLSAEKQQSLREALQSALG
Ga0307471_10221792923300032180Hardwood Forest SoilALIDTEGQKAIDVFYLTEQAKKLGTEKQDLLRASLQHALA
Ga0335078_1169477413300032805SoilIDTEGQKAIDVFYLTSQGKKLLPQKQELLKEVLQGTLS
Ga0335084_1228719513300033004SoilTEGQKAIDVFYLTSQGKKLAAQKQELLKEVLQGTLS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.