Basic Information | |
---|---|
Family ID | F079035 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 43 residues |
Representative Sequence | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADEALAVDVAAG |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.66 % |
% of genes near scaffold ends (potentially truncated) | 93.97 % |
% of genes from short scaffolds (< 2000 bps) | 96.55 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.621 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.828 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.414 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.966 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF02566 | OsmC | 43.97 |
PF00487 | FA_desaturase | 7.76 |
PF12697 | Abhydrolase_6 | 6.90 |
PF13466 | STAS_2 | 5.17 |
PF06197 | DUF998 | 2.59 |
PF00583 | Acetyltransf_1 | 2.59 |
PF05731 | TROVE | 2.59 |
PF01047 | MarR | 1.72 |
PF00106 | adh_short | 1.72 |
PF01061 | ABC2_membrane | 0.86 |
PF00196 | GerE | 0.86 |
PF00293 | NUDIX | 0.86 |
PF03551 | PadR | 0.86 |
PF12802 | MarR_2 | 0.86 |
PF12695 | Abhydrolase_5 | 0.86 |
PF12680 | SnoaL_2 | 0.86 |
PF12833 | HTH_18 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 43.97 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 43.97 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 7.76 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 7.76 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 2.59 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.86 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.86 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.62 % |
Unclassified | root | N/A | 16.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101816852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10066780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1396 | Open in IMG/M |
3300005327|Ga0070658_10168676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1838 | Open in IMG/M |
3300005337|Ga0070682_100109668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1837 | Open in IMG/M |
3300005406|Ga0070703_10132999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
3300005434|Ga0070709_10903162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
3300005434|Ga0070709_11611047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
3300005435|Ga0070714_100685481 | Not Available | 988 | Open in IMG/M |
3300005445|Ga0070708_101320717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300005542|Ga0070732_10631271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300005554|Ga0066661_10679589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300005587|Ga0066654_10542359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 640 | Open in IMG/M |
3300005591|Ga0070761_10157245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1334 | Open in IMG/M |
3300005712|Ga0070764_10897567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
3300005840|Ga0068870_10307008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
3300005921|Ga0070766_10437597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 862 | Open in IMG/M |
3300006028|Ga0070717_10353330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1314 | Open in IMG/M |
3300006175|Ga0070712_100279312 | Not Available | 1344 | Open in IMG/M |
3300006755|Ga0079222_10379581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
3300006804|Ga0079221_10283923 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300006806|Ga0079220_10165248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1238 | Open in IMG/M |
3300006806|Ga0079220_10413247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
3300006854|Ga0075425_100450990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
3300006871|Ga0075434_100618706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
3300009090|Ga0099827_10119231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2123 | Open in IMG/M |
3300009525|Ga0116220_10078455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1389 | Open in IMG/M |
3300009551|Ga0105238_10204535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1950 | Open in IMG/M |
3300009698|Ga0116216_10364123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
3300009824|Ga0116219_10194164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1164 | Open in IMG/M |
3300010047|Ga0126382_10799200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
3300010301|Ga0134070_10371314 | Not Available | 559 | Open in IMG/M |
3300010326|Ga0134065_10296693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300010358|Ga0126370_12628265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300010360|Ga0126372_13249888 | Not Available | 505 | Open in IMG/M |
3300010373|Ga0134128_11916079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 652 | Open in IMG/M |
3300010379|Ga0136449_103898218 | Not Available | 559 | Open in IMG/M |
3300010396|Ga0134126_11852414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
3300010398|Ga0126383_11862785 | Not Available | 690 | Open in IMG/M |
3300010403|Ga0134123_10356977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
3300012096|Ga0137389_10152466 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
3300012181|Ga0153922_1144134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300012189|Ga0137388_11556932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 597 | Open in IMG/M |
3300012202|Ga0137363_10408740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1131 | Open in IMG/M |
3300012203|Ga0137399_10158794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1812 | Open in IMG/M |
3300012961|Ga0164302_11738024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300012988|Ga0164306_10230867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1316 | Open in IMG/M |
3300013102|Ga0157371_10406298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
3300013296|Ga0157374_10427201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
3300015373|Ga0132257_100588484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1374 | Open in IMG/M |
3300017822|Ga0187802_10204293 | Not Available | 760 | Open in IMG/M |
3300017972|Ga0187781_10575135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 811 | Open in IMG/M |
3300018044|Ga0187890_10154837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1312 | Open in IMG/M |
3300018060|Ga0187765_10225873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300018433|Ga0066667_10895199 | Not Available | 763 | Open in IMG/M |
3300020081|Ga0206354_10163438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1326 | Open in IMG/M |
3300021170|Ga0210400_10619990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 892 | Open in IMG/M |
3300021178|Ga0210408_10420435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1064 | Open in IMG/M |
3300021180|Ga0210396_11755176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300021403|Ga0210397_11244823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300021404|Ga0210389_11017267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 642 | Open in IMG/M |
3300021404|Ga0210389_11113659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300021433|Ga0210391_10383372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1103 | Open in IMG/M |
3300025321|Ga0207656_10683179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300025898|Ga0207692_10173754 | Not Available | 1250 | Open in IMG/M |
3300025899|Ga0207642_10306464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
3300025906|Ga0207699_11143084 | Not Available | 577 | Open in IMG/M |
3300025911|Ga0207654_10173593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
3300025915|Ga0207693_10146184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1859 | Open in IMG/M |
3300025915|Ga0207693_10258242 | Not Available | 1366 | Open in IMG/M |
3300025916|Ga0207663_10361630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
3300025916|Ga0207663_11082514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 644 | Open in IMG/M |
3300025922|Ga0207646_11073592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
3300025928|Ga0207700_10246259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
3300025934|Ga0207686_11054704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300025935|Ga0207709_11148717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300025938|Ga0207704_11296722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300025945|Ga0207679_11504822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
3300026277|Ga0209350_1159277 | Not Available | 511 | Open in IMG/M |
3300027047|Ga0208730_1009046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1049 | Open in IMG/M |
3300027288|Ga0208525_1021934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300027523|Ga0208890_1070798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
3300027765|Ga0209073_10083339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
3300027884|Ga0209275_10703691 | Not Available | 582 | Open in IMG/M |
3300027895|Ga0209624_10871364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 589 | Open in IMG/M |
3300028784|Ga0307282_10188980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
3300028789|Ga0302232_10325447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
3300029882|Ga0311368_10094233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2574 | Open in IMG/M |
3300029999|Ga0311339_10955992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
3300030494|Ga0310037_10304655 | Not Available | 678 | Open in IMG/M |
3300030524|Ga0311357_11615039 | Not Available | 545 | Open in IMG/M |
3300030707|Ga0310038_10194047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 974 | Open in IMG/M |
3300030743|Ga0265461_12653151 | Not Available | 595 | Open in IMG/M |
3300031545|Ga0318541_10161904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
3300031680|Ga0318574_10673656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300031716|Ga0310813_11618977 | Not Available | 605 | Open in IMG/M |
3300031748|Ga0318492_10755575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300031764|Ga0318535_10268015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
3300031765|Ga0318554_10619565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300031777|Ga0318543_10517847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300031860|Ga0318495_10356673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300031946|Ga0310910_11481570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300031954|Ga0306926_11892254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 674 | Open in IMG/M |
3300032008|Ga0318562_10276474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 976 | Open in IMG/M |
3300032008|Ga0318562_10763191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300032039|Ga0318559_10299503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300032044|Ga0318558_10270723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
3300032066|Ga0318514_10464369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300032067|Ga0318524_10156425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
3300032091|Ga0318577_10072390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1582 | Open in IMG/M |
3300032180|Ga0307471_102412527 | Not Available | 665 | Open in IMG/M |
3300032180|Ga0307471_102877476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 611 | Open in IMG/M |
3300032805|Ga0335078_10174548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3014 | Open in IMG/M |
3300032892|Ga0335081_10667427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1268 | Open in IMG/M |
3300032896|Ga0335075_11085191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
3300032897|Ga0335071_10006198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12344 | Open in IMG/M |
3300033134|Ga0335073_12066807 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.07% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.17% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.45% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.72% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.86% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1018168522 | 3300002245 | Forest Soil | MENAGPSVTARRVAAYRLGFTRVAAPYGDAAADQALAADVA |
JGIcombinedJ51221_100667801 | 3300003505 | Forest Soil | MKDGTASHTARRVAAHRLEYERVAADYGDPAADLALTVDVA |
Ga0070658_101686762 | 3300005327 | Corn Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGR* |
Ga0070682_1001096683 | 3300005337 | Corn Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAG |
Ga0070703_101329992 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHALSVDVAAGR* |
Ga0070709_109031622 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGR* |
Ga0070709_116110471 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARHVAAHRLEFTRVHADYGDPAADQALAVDVAAG |
Ga0070714_1006854813 | 3300005435 | Agricultural Soil | MADGEPLGPSVTARRVAAYRLGFTRVPAPYGDAAADEALAADVAAG |
Ga0070708_1013207171 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARWVAAHRLDFTRIPADYGDPAADHALAVDVAA |
Ga0070732_106312712 | 3300005542 | Surface Soil | MDLDSGPSLTAQRVAAHRLSFARPGWPHGNPAADDALAADVVAGSVTGQ |
Ga0066661_106795891 | 3300005554 | Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADQALAVDVAAGHQAQ |
Ga0066654_105423592 | 3300005587 | Soil | MEHGGPSQTARRVAAHRVDFTRVPADYGDPAADRALALDVAAGRQAPAS |
Ga0070761_101572453 | 3300005591 | Soil | MDDGGPSATARRVAAYRLGFTRVAASYGNPAADEALAADV |
Ga0070764_108975671 | 3300005712 | Soil | MITDGGPSVTAKRVAAHRLTYDRIPWQHGDPAADDALAADIAAGA |
Ga0068870_103070081 | 3300005840 | Miscanthus Rhizosphere | ARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGR* |
Ga0070766_104375973 | 3300005921 | Soil | MEGAGPSVTAQRVAAHRLGFTRVPAPYGDPAADEA |
Ga0070717_103533303 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARHVAAHRLEFTRVHADYGDPAADQALAVDVAA |
Ga0070712_1002793121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSVTARRVAAHRLGFSRIPAAYGDPAADQALAADVAA |
Ga0079222_103795811 | 3300006755 | Agricultural Soil | MEDGGPSQTARRVAAHRLGFTRIPADYGDPAADHALAVDVAAG |
Ga0079221_102839232 | 3300006804 | Agricultural Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGEPAADEALAVDVAAGHQVPA |
Ga0079220_101652482 | 3300006806 | Agricultural Soil | MEDAGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGPGGTQDA* |
Ga0079220_104132473 | 3300006806 | Agricultural Soil | MEDGGPSQTARRVAAYRLDFTRIPADYGDPAADHALAVDVAAGRQA |
Ga0075425_1004509901 | 3300006854 | Populus Rhizosphere | MEDGGPSQTARRVAAHRLDFRRIPADYGHPAADHALAVDVAAGRQAPA |
Ga0075434_1006187061 | 3300006871 | Populus Rhizosphere | MEDGGPSVTARWVAAHRLGFARVAADYGDPAADEALAADVAAGRAAPAR |
Ga0099827_101192313 | 3300009090 | Vadose Zone Soil | MEDGGPSATARRVAAHRLGFTRVPAAYGDPAADEALAA |
Ga0116220_100784553 | 3300009525 | Peatlands Soil | MDDGGPSVTARRVAAHRLGFSRIPAAYGVPAADEALAASDP* |
Ga0105238_102045351 | 3300009551 | Corn Rhizosphere | MEDGGPSVTARRVAAHRLGFTRIATDYGDPAADEALA |
Ga0116216_103641231 | 3300009698 | Peatlands Soil | MEDGGPSVTARRVAAHRLGFSRVPAAYGVPAADDALAADVAAGL |
Ga0116219_101941641 | 3300009824 | Peatlands Soil | MIEGRPSETAQRVAAHRLAFERVATKYGNPAADMALATDVAG |
Ga0126382_107992003 | 3300010047 | Tropical Forest Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADQALA |
Ga0134070_103713142 | 3300010301 | Grasslands Soil | MEHGGPSQTARWVAAHRLDFTRVPADYGEPAADHALAVDVAAGRQA |
Ga0134065_102966932 | 3300010326 | Grasslands Soil | MEDGGPSQTAHRVAAHRLDFTRVPADYGDPAADHALAVDVAAGR |
Ga0126370_126282652 | 3300010358 | Tropical Forest Soil | MEHGGPSQTARRVAAHRLDFTRVPADYGDPAADHALAVDVAAGRQA |
Ga0126372_132498882 | 3300010360 | Tropical Forest Soil | MEDGGPSQTARRVAAYRLDFDRVPADYGDPAADQALTADVAAGHRVQ |
Ga0134128_119160792 | 3300010373 | Terrestrial Soil | MEDGGPSVTARWVAAHRLGFARVATDYGDPAADEA |
Ga0136449_1038982181 | 3300010379 | Peatlands Soil | MDDGGPSVTARRVAAHRLGFSRVPAAYGVPAADEALAADVAAGLVA |
Ga0134126_118524141 | 3300010396 | Terrestrial Soil | SQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGR* |
Ga0126383_118627851 | 3300010398 | Tropical Forest Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADQALAADVAD |
Ga0134123_103569771 | 3300010403 | Terrestrial Soil | MEDGGPSQTARRVAAHRLDFRRIPADYGDPAADHA |
Ga0137389_101524665 | 3300012096 | Vadose Zone Soil | MEDGGPSATARRVAAHRLGFTRVPAAYGDPAADEAL |
Ga0153922_11441342 | 3300012181 | Attine Ant Fungus Gardens | MSGPSITARRVAAYRLGFTRVPAPYGDAAADETLAADVAAGQEPA |
Ga0137388_115569321 | 3300012189 | Vadose Zone Soil | MEDGGPSATARRVAAHRLGFTRVPAAYGDPAADEALAADVAA |
Ga0137363_104087403 | 3300012202 | Vadose Zone Soil | MEEGGPSVTARRVAAHRLGFTRVATDYGDPAADEALAADVAAGRAAPA |
Ga0137399_101587944 | 3300012203 | Vadose Zone Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADEALAVDVAAGRQAPA |
Ga0164302_117380241 | 3300012961 | Soil | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADYAL |
Ga0164306_102308671 | 3300012988 | Soil | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHVLAVDVAAGR* |
Ga0157371_104062981 | 3300013102 | Corn Rhizosphere | MEDGGPSVTARWVAAHRLGFARVATDYGDPAADEAMAAEVAAGR |
Ga0157374_104272011 | 3300013296 | Miscanthus Rhizosphere | MEDGGPSVTARRVAAHRLGFTRIATDYGDPAADEALAADVAAGR |
Ga0132257_1005884841 | 3300015373 | Arabidopsis Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGEPAADDALA |
Ga0187802_102042931 | 3300017822 | Freshwater Sediment | MEDGGPSVTARRVAAHRLGFSRVPAPYGAPAADEA |
Ga0187781_105751353 | 3300017972 | Tropical Peatland | MEDGGPSVTARRVAAHRLGFTRVPAAYGDPAADETLAAD |
Ga0187890_101548371 | 3300018044 | Peatland | MEDGGPSITARRVAAHRLGFTRVSAPYGDPAADDAL |
Ga0187765_102258733 | 3300018060 | Tropical Peatland | MKDGGPSATARQVAAHRLGFTRVPAAYGDPAADQTLAADVAAGLQAPA |
Ga0066667_108951993 | 3300018433 | Grasslands Soil | MGQMKDGRPSVTARRVAAHRLGFTRVATDYGDPAADEALA |
Ga0206354_101634382 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGR |
Ga0210400_106199903 | 3300021170 | Soil | MKDGTASHTARRVAAHRLEYERVAADYGDPAADLALTVDVAGQEQPTPGRM |
Ga0210408_104204353 | 3300021178 | Soil | MEDGGPSVTARRVAAHRLGFSRIAADYGDPAADEALAADV |
Ga0210396_117551761 | 3300021180 | Soil | MEDGGPSLTARRVAAHRLGFSRVPAAYGVPAADDALAAD |
Ga0210397_112448231 | 3300021403 | Soil | MEDGGPSLTARRVAAHRLGFSRVPAAYGVPAADDALAADVAA |
Ga0210389_110172672 | 3300021404 | Soil | MEDGGPSVTARRVAAHRLGFARVATDYGDPAADEAMAADV |
Ga0210389_111136591 | 3300021404 | Soil | MDDGGPSATARRVAAYRLGFTRVAASYGNPAADEALAADVAAGQQPS |
Ga0210391_103833721 | 3300021433 | Soil | MEDRGPSVTARRVAAHRLGFSRVSAAYGVPAADEALAADVAAGLV |
Ga0207656_106831791 | 3300025321 | Corn Rhizosphere | MEDGGPSQTARRVAAHRLDFRRIPADYGDPAADHALAVDVAAGRQAPA |
Ga0207692_101737543 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDV |
Ga0207642_103064642 | 3300025899 | Miscanthus Rhizosphere | MEDGGPSVTARWVAAHRLGFARVATDYGDPAADEALAADVAAGRAAPAN |
Ga0207699_111430841 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSVTARWVAAHRLGFARVATGYGDPAADEALAADVAAGRA |
Ga0207654_101735931 | 3300025911 | Corn Rhizosphere | MEDGGPSQTARRVAAHRLDFSRIPADYGDPAADHALAV |
Ga0207693_101461844 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSVTARRVAAHRLGFTRIATDYGDPAADEALAADVAAGQTAPAG |
Ga0207693_102582421 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSVTARRVAAHRLGFSRIPAAYGDPAADQALAADVAAGH |
Ga0207663_103616301 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADEALAVDVAAG |
Ga0207663_110825142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSVTARRVAAHRLGFTRIATDYGDPAADEALAADVAAGAT |
Ga0207646_110735922 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARWVAAHRLDFTRIPADYGDPAADHALAVDVAAGRQAPA |
Ga0207700_102462591 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADQALAVDVAAGHQ |
Ga0207686_110547042 | 3300025934 | Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGRQ |
Ga0207709_111487172 | 3300025935 | Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFRRIPADYGHPAADYALAVDVA |
Ga0207704_112967221 | 3300025938 | Miscanthus Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHAL |
Ga0207679_115048222 | 3300025945 | Corn Rhizosphere | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADHA |
Ga0209350_11592771 | 3300026277 | Grasslands Soil | MEDGGPSQTARGVAAHRLDFTRVPADYGDPAADHALAVDVAA |
Ga0208730_10090463 | 3300027047 | Forest Soil | MDHGGPSATARRVAAYRLGFTRVPAPYGDPAADEAL |
Ga0208525_10219342 | 3300027288 | Soil | MEDGGPSVTARWVAAHRLGFARVATDYGDPAADEALAADVAAGRAAPA |
Ga0208890_10707982 | 3300027523 | Soil | MEDGGPSVTARWVAAHRLGFARVATDYGDPAADEALAADVAAGR |
Ga0209073_100833391 | 3300027765 | Agricultural Soil | MEDAGPSQTARRVAAHRLDFTRIPADYGDPAADHALAVDVAAGPGGTQDA |
Ga0209275_107036911 | 3300027884 | Soil | MEDGGPSVTARRVAAHRLGFSRVAAAYGVPAVDDALAADVA |
Ga0209624_108713642 | 3300027895 | Forest Soil | MLMKDGTASQTARSVAAHRLEYERVAADYGDPAADQSLTVDVADGR |
Ga0307282_101889803 | 3300028784 | Soil | MEDGGPSQTARLVAAHRLDFNRIPADYGDPAADHALAVD |
Ga0302232_103254473 | 3300028789 | Palsa | VQDGGPSITARSVAAHRLGFTRVPAPYGDPAADDALAVDVAAGRDAP |
Ga0311368_100942334 | 3300029882 | Palsa | MKDGGPSITAQWVAAHRLGFTRVAAPYGDPAADDALA |
Ga0311339_109559921 | 3300029999 | Palsa | MEDGGPSITARRVAAHRLGFTRVPAPYGDPAADDALAT |
Ga0310037_103046551 | 3300030494 | Peatlands Soil | MEDGGPSVTARRVAAHRLGFSRVPAPYGVPTADDALAADV |
Ga0311357_116150392 | 3300030524 | Palsa | MPERSPSLTAQRVAAYRLGFDRLQTPYGDPGADDALA |
Ga0310038_101940471 | 3300030707 | Peatlands Soil | MEDGGPSVTARRVAAHRLGFSRVPAAYGVPAADEALAADVAAGL |
Ga0265461_126531511 | 3300030743 | Soil | MIEGRPSETAQRVAAHRLAFERVATKYGNPAADMALATDVAGWPQH |
Ga0318541_101619043 | 3300031545 | Soil | MEEGGPSQTARRVAAHRLDFTRVPADYGDPAADQALAVDVAARWSCIRLA |
Ga0318574_106736562 | 3300031680 | Soil | MEDGGPSVTARRVAAHRLGFDRVPVAYGDPAADEALAADVAAGWRIVAG |
Ga0310813_116189771 | 3300031716 | Soil | MEHGGPSQTARWVAAHRLDFIRVPADYGDPAADDAL |
Ga0318492_107555752 | 3300031748 | Soil | MEDGGPSETARRVAAHRLGFDRVPVAYGDPAADEVLAAD |
Ga0318535_102680151 | 3300031764 | Soil | MEDGGPSQTAHRVAAYRLDFDRVPADYGDPAADQALTADVAAGHRVQAGRHIG |
Ga0318554_106195651 | 3300031765 | Soil | MEDGGPSETARRVAAHRLGFDRVPVAYGDPAADEVLA |
Ga0318543_105178471 | 3300031777 | Soil | MEDGGPSQTAHRVAAYRLDFDRVPADYGDPAADQALTADVAAGHRV |
Ga0318495_103566732 | 3300031860 | Soil | MEDGGPSQIARRVAAHRLDFARVPADYGDPAADQALAADVAAR |
Ga0310910_114815701 | 3300031946 | Soil | MRDGGPSQTARRVAAYRLDFTRVPADYGVPAADQALAADVAGGLLAPA |
Ga0306926_118922541 | 3300031954 | Soil | MEDGGPSQTARRVAAHRLDFTRLPADYGNPAADQALAVDVAAE |
Ga0318562_102764741 | 3300032008 | Soil | MEDGGPSQTARRVAAHRLDFTRVPADFGDPAADLALAVDVA |
Ga0318562_107631912 | 3300032008 | Soil | MEDGGPSETARRVAAHRLGFDRVPVAYGDPAADEVLAADV |
Ga0318559_102995031 | 3300032039 | Soil | MEDGGPSQTAHRVAAYRLDFDRVPADYGDPAADQALTADVAAGHRVQAGRM |
Ga0318558_102707233 | 3300032044 | Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADQALATDVANGLLA |
Ga0318514_104643691 | 3300032066 | Soil | MEDGGPSQTARRVAAHRLDFTRVPADYGDPAADLALAADVAGG |
Ga0318524_101564253 | 3300032067 | Soil | MRDGGPSQTARRVAAYRLDFTRVPADYGVPAADQALAADVAAGHRAPASRM |
Ga0318577_100723904 | 3300032091 | Soil | MEDGGPSQTAHRVAAYRLDFDRVPADYGDPAADQALTADVA |
Ga0307471_1024125271 | 3300032180 | Hardwood Forest Soil | MDDGGPSVTARRVAAHRLGFTRVAAEYGDPAADEALAADVAAGRAAPAN |
Ga0307471_1028774761 | 3300032180 | Hardwood Forest Soil | MEDGGPSETARRVAAHRLGYIRVAADYGDPAADEARAADVAVGRAAPA |
Ga0335078_101745487 | 3300032805 | Soil | MDDGSPSATARRVAAHRLGFSRVPAAYGVPAADEALTRDVAADQV |
Ga0335081_106674273 | 3300032892 | Soil | MEDGGPSVTARRVAAYRLGFDRVATDYGDPAADQALTADVA |
Ga0335075_110851913 | 3300032896 | Soil | MEHGGPSATASRVAAHRLTFTRVAADYGDPAADDALAADVAAGLE |
Ga0335071_100061981 | 3300032897 | Soil | MEDGGPSQTARRVAAHRLDFTRIPADYGDPAADQALA |
Ga0335073_120668072 | 3300033134 | Soil | VRDGRPSATAQRVAAHRLGYERIATPYGDPSADEALAR |
⦗Top⦘ |