Metagenome / Metatranscriptome Family F079013

Overview

Basic Information

• Family ID: F079013
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 116
• Average Sequence Length: 40 residues
• Representative Sequence: VGKKVTEGTVEVVHRSTREMQDASIGAITEYFQKLLRPAR
• Number of Associated Samples: 109
• Number of Associated Scaffolds: 116

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 88.79 %
• % of genes from short scaffolds (< 2000 bps): 77.59 %
• Associated GOLD sequencing projects: 104
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (87.069 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (12.069 % of family members)
• Environment Ontology (ENVO): Unclassified (26.724 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (43.103 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 16.18%
  β-sheet: 25.00%
  Coil/Unstructured: 58.82%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 116 Family Scaffolds
PF00912	Transgly	17.24
PF16137	DUF4845	8.62
PF10282	Lactonase	2.59
PF00117	GATase	0.86
PF08494	DEAD_assoc	0.86
PF00793	DAHP_synth_1	0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 116 Family Scaffolds
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	17.24
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	17.24
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	17.24
COG1201	Lhr-like helicase	Replication, recombination and repair [L]	0.86

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	87.07 %
Unclassified	root	N/A	12.93 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.07 %
Unclassified	root	N/A	12.93 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	87.07 %
Unclassified	root	N/A	12.93 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	35.34 %
Unclassified	root	N/A	12.93 %

Level 5

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	14.66 %
Unclassified	root	N/A	12.93 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	3.45 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	14.66 %
Unclassified	root	N/A	12.93 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.45 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	12.93 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	10.34 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	4.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.45 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	12.93 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	9.48 %
Acidobacteriales bacterium 13_1_40CM_3_55_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	4.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.45 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	12.93 %
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5.17 %
Acidobacteriales bacterium 13_1_40CM_3_55_5	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	4.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	3.45 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000652|ARCol0yngRDRAFT_1014965	All Organisms → cellular organisms → Bacteria	583
3300000955|JGI1027J12803_102442736	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1800
3300001867|JGI12627J18819_10395586	All Organisms → cellular organisms → Bacteria	562
3300005174|Ga0066680_10757443	All Organisms → cellular organisms → Bacteria	589
3300005175|Ga0066673_10244377	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1038
3300005176|Ga0066679_10883513	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	564
3300005181|Ga0066678_10745492	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	650
3300005290|Ga0065712_10348612	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	790
3300005334|Ga0068869_100590821	All Organisms → cellular organisms → Bacteria	937
3300005440|Ga0070705_101135284	All Organisms → cellular organisms → Bacteria	641
3300005441|Ga0070700_100302525	All Organisms → cellular organisms → Bacteria	1168
3300005445|Ga0070708_101625563	All Organisms → cellular organisms → Bacteria	601
3300005533|Ga0070734_10615728	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	618
3300005538|Ga0070731_10581212	All Organisms → cellular organisms → Bacteria	746
3300005549|Ga0070704_101036848	All Organisms → cellular organisms → Bacteria	743
3300005560|Ga0066670_10558720	All Organisms → cellular organisms → Bacteria	699
3300005568|Ga0066703_10622278	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	627
3300005602|Ga0070762_10082006	All Organisms → cellular organisms → Bacteria → Acidobacteria	1836
3300005921|Ga0070766_11143277	All Organisms → cellular organisms → Bacteria → Acidobacteria	538
3300006034|Ga0066656_11128429	All Organisms → cellular organisms → Bacteria → Acidobacteria	504
3300006046|Ga0066652_101506893	All Organisms → cellular organisms → Bacteria → Acidobacteria	623
3300006059|Ga0075017_100543064	All Organisms → cellular organisms → Bacteria	885
3300006059|Ga0075017_101119989	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	615
3300006162|Ga0075030_100476568	All Organisms → cellular organisms → Bacteria	993
3300006175|Ga0070712_101075621	All Organisms → cellular organisms → Bacteria	697
3300006175|Ga0070712_101670081	All Organisms → cellular organisms → Bacteria	557
3300006354|Ga0075021_10932476	All Organisms → cellular organisms → Bacteria	564
3300006358|Ga0068871_101780250	All Organisms → cellular organisms → Bacteria	585
3300006893|Ga0073928_10986424	All Organisms → cellular organisms → Bacteria	574
3300007258|Ga0099793_10253837	All Organisms → cellular organisms → Bacteria	849
3300007982|Ga0102924_1097734	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	1491
3300009038|Ga0099829_10923003	All Organisms → cellular organisms → Bacteria	724
3300009090|Ga0099827_10917966	All Organisms → cellular organisms → Bacteria	759
3300009101|Ga0105247_11040062	All Organisms → cellular organisms → Bacteria	642
3300009137|Ga0066709_102656951	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	669
3300009545|Ga0105237_10761287	All Organisms → cellular organisms → Bacteria	975
3300009551|Ga0105238_10975160	Not Available	868
3300009700|Ga0116217_10191136	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	1349
3300010048|Ga0126373_10437982	All Organisms → cellular organisms → Bacteria → Acidobacteria	1339
3300010366|Ga0126379_10176300	All Organisms → cellular organisms → Bacteria	2027
3300010376|Ga0126381_103596533	All Organisms → cellular organisms → Bacteria → Acidobacteria	608
3300010379|Ga0136449_101867988	All Organisms → cellular organisms → Bacteria	895
3300010397|Ga0134124_10002831	All Organisms → cellular organisms → Bacteria	14004
3300010401|Ga0134121_11605585	All Organisms → cellular organisms → Bacteria	670
3300012189|Ga0137388_11145188	All Organisms → cellular organisms → Bacteria	715
3300012202|Ga0137363_10912163	All Organisms → cellular organisms → Bacteria → Acidobacteria	746
3300012203|Ga0137399_11677269	All Organisms → cellular organisms → Bacteria	524
3300012206|Ga0137380_11145822	All Organisms → cellular organisms → Bacteria	661
3300012211|Ga0137377_11942107	All Organisms → cellular organisms → Bacteria	505
3300012212|Ga0150985_109807762	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2693
3300012361|Ga0137360_10188107	All Organisms → cellular organisms → Bacteria → Acidobacteria	1664
3300012944|Ga0137410_10490064	All Organisms → cellular organisms → Bacteria	1003
3300012988|Ga0164306_11092027	All Organisms → cellular organisms → Bacteria	663
3300014157|Ga0134078_10657458	All Organisms → cellular organisms → Bacteria → Acidobacteria	509
3300014501|Ga0182024_12658806	All Organisms → cellular organisms → Bacteria	536
3300014502|Ga0182021_12942810	All Organisms → cellular organisms → Bacteria	571
3300015265|Ga0182005_1213055	All Organisms → cellular organisms → Bacteria	585
3300015371|Ga0132258_10118887	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	6274
3300015373|Ga0132257_100314248	All Organisms → cellular organisms → Bacteria	1885
3300016404|Ga0182037_10236961	All Organisms → cellular organisms → Bacteria	1437
3300017932|Ga0187814_10366055	All Organisms → cellular organisms → Bacteria	558
3300017955|Ga0187817_10119332	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	1668
3300018062|Ga0187784_11349583	Not Available	565
3300020580|Ga0210403_11049407	All Organisms → cellular organisms → Bacteria	635
3300021088|Ga0210404_10637729	All Organisms → cellular organisms → Bacteria	606
3300021170|Ga0210400_11359343	All Organisms → cellular organisms → Bacteria	567
3300021402|Ga0210385_11538095	All Organisms → cellular organisms → Bacteria	508
3300021403|Ga0210397_10801692	All Organisms → cellular organisms → Bacteria → Acidobacteria	727
3300021406|Ga0210386_10492150	All Organisms → cellular organisms → Bacteria	1060
3300021477|Ga0210398_11493389	All Organisms → cellular organisms → Bacteria → Acidobacteria	526
3300022557|Ga0212123_10910244	All Organisms → cellular organisms → Bacteria → Acidobacteria	517
3300022722|Ga0242657_1080166	All Organisms → cellular organisms → Bacteria → Acidobacteria	774
3300022724|Ga0242665_10247989	All Organisms → cellular organisms → Bacteria	605
3300022726|Ga0242654_10362879	All Organisms → cellular organisms → Bacteria	548
3300025627|Ga0208220_1101299	All Organisms → cellular organisms → Bacteria	774
3300025907|Ga0207645_10013312	All Organisms → cellular organisms → Bacteria	5551
3300025913|Ga0207695_10367811	All Organisms → cellular organisms → Bacteria → Acidobacteria	1324
3300025915|Ga0207693_10014194	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	6412
3300025915|Ga0207693_10016284	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5944
3300025915|Ga0207693_11336141	All Organisms → cellular organisms → Bacteria	535
3300025922|Ga0207646_10057360	All Organisms → cellular organisms → Bacteria	3479
3300025925|Ga0207650_11162382	All Organisms → cellular organisms → Bacteria	657
3300025928|Ga0207700_10489526	All Organisms → cellular organisms → Bacteria	1087
3300025929|Ga0207664_11453135	All Organisms → cellular organisms → Bacteria	607
3300026142|Ga0207698_11171619	All Organisms → cellular organisms → Bacteria	782
3300026331|Ga0209267_1150021	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	960
3300027829|Ga0209773_10050434	All Organisms → cellular organisms → Bacteria → Acidobacteria	1679
3300027874|Ga0209465_10081347	All Organisms → cellular organisms → Bacteria	1577
3300027875|Ga0209283_10099263	All Organisms → cellular organisms → Bacteria → Acidobacteria	1904
3300028381|Ga0268264_10164362	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2002
3300029922|Ga0311363_10094153	All Organisms → cellular organisms → Bacteria	4167
3300030114|Ga0311333_10673059	All Organisms → cellular organisms → Bacteria	861
3300030706|Ga0310039_10078080	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	1414
3300031090|Ga0265760_10115501	All Organisms → cellular organisms → Bacteria	858
3300031128|Ga0170823_10650297	All Organisms → cellular organisms → Bacteria → Acidobacteria	961
3300031231|Ga0170824_110800675	All Organisms → cellular organisms → Bacteria → Acidobacteria	616
3300031708|Ga0310686_101104308	All Organisms → cellular organisms → Bacteria	4377
3300031718|Ga0307474_10429555	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5	1031
3300031718|Ga0307474_11025857	All Organisms → cellular organisms → Bacteria	653
3300031754|Ga0307475_10979169	All Organisms → cellular organisms → Bacteria	665
3300031954|Ga0306926_10518122	All Organisms → cellular organisms → Bacteria → Acidobacteria	1464
3300032892|Ga0335081_10294794	All Organisms → cellular organisms → Bacteria → Acidobacteria	2153
3300033412|Ga0310810_10006450	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	13266

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.90%
Host-Associated	Host-Associated	18.10%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	73.28%
Plants	Host-Associated → Plants	18.10%
Aquatic	Environmental → Aquatic	8.62%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	71.55%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.62%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.62%
Sediment	Environmental → Aquatic → Sediment	3.45%
Freshwater	Environmental → Aquatic → Freshwater	2.59%
Thermal Springs	Environmental → Aquatic → Thermal Springs	2.59%
Peat	Environmental → Terrestrial → Peat	1.72%
Roots	Host-Associated → Plants → Roots	0.86%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.00%
Loam	Environmental → Terrestrial → Soil → Loam	18.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.03%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.45%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.45%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.59%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	2.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.59%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.72%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.86%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	14.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	13.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.62%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.45%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.45%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.45%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	2.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.59%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.72%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.72%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.72%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.72%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.86%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.86%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.86%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.86%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.86%

Habitat

Habitat	Taxonomy	Distribution
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	12.07%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.21%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.31%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.45%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	2.59%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.59%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.59%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.59%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.59%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.72%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.72%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.72%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.72%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.72%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.72%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.72%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.86%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.86%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.86%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.86%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.86%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.86%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.86%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.86%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.86%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.86%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.86%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.86%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.86%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.86%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Host-Associated
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental
3300003321	Sugarcane bulk soil Sample H1	Environmental
3300005174	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129	Environmental
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental
3300006162	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental
3300007982	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009700	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental
3300017932	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4	Environmental
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021402	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O	Environmental
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental
3300021477	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O	Environmental
3300022557	Paint Pots_combined assembly	Environmental
3300022722	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental
3300025627	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)	Environmental
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental
3300027829	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)	Environmental
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300029922	III_Fen_E1 coassembly	Environmental
3300030114	I_Fen_E2 coassembly	Environmental
3300030706	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)	Environmental
3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Environmental
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ARCol0yngRDRAFT_10149651	3300000652	Arabidopsis Rhizosphere	EGTVEVVQRSTRQMQDASISAITDYFGKNLRSAR*
JGI1027J12803_1024427361	3300000955	Soil	TDDTVEVVRRSTREMRDVSIAAIIEYFEQNLRPAR*
JGI12627J18819_103955861	3300001867	Forest Soil	KVTEGTVEVVQRSTRQIQDASIGGITDYFGNLLPRAL*
soilH1_101000241	3300003321	Sugarcane Root And Bulk Soil	GKKVTEDRVEVVQRSTRQSQDVSIGAITDYFRQKLGPARRT*
Ga0066680_107574431	3300005174	Soil	VTVGKKVTEGTIEIVQRSTREVHDASIDAVTDYFQKLFRPAR*
Ga0066673_102443771	3300005175	Soil	KKVTDGTVEVVHRSTRESHDVSIAAMTQYFQQFLGTARQSEH*
Ga0066679_108835131	3300005176	Soil	VGKKVTEGTVEVVHRSTREMQDASIGAITEYFQKLLRPAR*
Ga0066678_107454922	3300005181	Soil	VGKKVTEGTIEIVQRSTREVHDASIDAVTDYFQKLFRPAR*
Ga0065712_103486123	3300005290	Miscanthus Rhizosphere	GKKVTEGTVEVVHRSTREIHDASIAAIADYFEPLLRPAR*
Ga0068869_1005908211	3300005334	Miscanthus Rhizosphere	VGKKVTEGTVEVVRRSTREIEDASISAISDYFEKNLRSAA*
Ga0070674_1009494301	3300005356	Miscanthus Rhizosphere	KKVTEDRVEVVRRSTRQSQDVTIGGITEYFRQNLGPARRT*
Ga0070714_1016726401	3300005435	Agricultural Soil	KKVTEDRVEVVQRSTRQSQDVSIGEITDYFRQNLGPARRT*
Ga0070713_1010763132	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	GKKVTEDRVEVVQRSTRQSQDVTIGEITEYFRQNLGPARRT*
Ga0070705_1011352841	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VGKKVTEGTVEVVRRSTREMQDASIAAITDYFETVLKPAR*
Ga0070700_1003025251	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	INVGKKVTEGTVEVVQRSTRQMQDASISAITDYFGKNLRSAR*
Ga0070708_1016255632	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	TVGKKVTEGTVEVVRRSTWQMEDASIAAITEYFEKNLRSAG*
Ga0070734_106157281	3300005533	Surface Soil	VGKKVTEGTVEVVHRSTREVHDASIAAITDYFEVLRPAR*
Ga0070731_105812121	3300005538	Surface Soil	KKVTEGTVEVVRRSTREMTDASIAAITEYFGKNLRLAG*
Ga0070704_1010368481	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	VGKKVTEGTVEVVQRSTRQMQDASISAITDYFGKNLRSAR*
Ga0066670_105587201	3300005560	Soil	NVGKKVTEGTVEVVQRSTRQLHDVSIGAIAEYFKKVLRPARK*
Ga0066703_106222781	3300005568	Soil	KKVTEGTVEIVQRSTREIHDASIGAVTDYFQSLLRPAR*
Ga0070762_100820064	3300005602	Soil	GKKVTEGTVEVVQRSTREVQDASIAAITDYFKAKRPAR*
Ga0068856_1026420992	3300005614	Corn Rhizosphere	VGKKVTEDRVEVVQRSTRQSQDVSIAAITDYFRQNLGPGRRT*
Ga0070766_111432771	3300005921	Soil	GKKVTEGTVEVVQRSTREMHDASIAGITDYFKALRPAR*
Ga0066656_111284292	3300006034	Soil	VTEGTVEVVRRSTRESADVSIGEIAEHFQKILGPTHQ*
Ga0066652_1015068931	3300006046	Soil	EGTVEVVQRSTRQLHDVSIGAIAEYFEKILRPGHK*
Ga0075017_1005430641	3300006059	Watersheds	GKKVTEGMVEVVQRSTRQSTDIRIFDITEYFKGLLPPLG*
Ga0075017_1011199891	3300006059	Watersheds	VTEGTIEVVQRSTREIRDASIAAITEYFDNLLRPAH*
Ga0075030_1004765683	3300006162	Watersheds	VGKKVTEGTVEVVRRSTRQIEDASIAAITEYFEKNLRSAG*
Ga0070712_1010756211	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	VGKKVTEGTVEVVQRSTRQMHDASIGAITEYFRNLLPAR*
Ga0070712_1016700812	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	PFRVNVGKKVTEGTVEVVQRSTRQMHDASIGAITEYFRNFLPAR*
Ga0075021_109324762	3300006354	Watersheds	EGTIEVVQRSTREMHDASISAITEYFEKLLGPAH*
Ga0068871_1017802501	3300006358	Miscanthus Rhizosphere	GKKVTEGTVEVVHRSTREMQDASIGAISEYFEKLLRPVR*
Ga0073928_109864241	3300006893	Iron-Sulfur Acid Spring	YRVNVGKKVTEGTVEVVQRSTHEMHDASIAAITDYFKALRPAR*
Ga0099793_102538373	3300007258	Vadose Zone Soil	VGKKVTEGTIEVVQRSTREMRDASISTITEYFEKLLRPAD*
Ga0102924_10977341	3300007982	Iron-Sulfur Acid Spring	KVTEGTVEVVQRSTREMHDASIAEITDYFKALQPAR*
Ga0099829_109230031	3300009038	Vadose Zone Soil	RITVGKKVTEGTVEVVRRSTRQMEDASISAISEYFKKNLRSAP*
Ga0099827_109179661	3300009090	Vadose Zone Soil	TEGTVEVVRRSTREMQDASIAAITDYFERVLRPVR*
Ga0105240_104399173	3300009093	Corn Rhizosphere	NVGKKVTEDRVEVVQRSTRQSQDVTIGAITEYFRQNLGPARRT*
Ga0105247_110400621	3300009101	Switchgrass Rhizosphere	KVTEGTVEVVHRSTREMQDASIGAISEFFEELLRPVR*
Ga0066709_1026569512	3300009137	Grasslands Soil	RVTVGKKVTEGTIEIVQRSTREVHDASIDAVTDYFQKLFRPAR*
Ga0105237_107612871	3300009545	Corn Rhizosphere	EGTVEVVRRSTREMQDASISAITDYFEKNLRSAH*
Ga0105238_109751601	3300009551	Corn Rhizosphere	NVGKKVTEGTVEVVHRSTREIHDASIAAIADYFEPLLRPAR*
Ga0116217_101911363	3300009700	Peatlands Soil	VGKKVTEGTVEVVQRSTREMQDASIAAITEYFGKLLQSAR*
Ga0126373_104379823	3300010048	Tropical Forest Soil	TVGKKVTEGTVEVVFRSTRQVHDVTISEIVEHFERLPARLG*
Ga0126379_101763001	3300010366	Tropical Forest Soil	VGKKVTEGTVEVVQRSTREIEDVSIASIGSYFEKRVRTAG*
Ga0105239_120545321	3300010375	Corn Rhizosphere	NVGKKVTEDRVEVVQRSTRQSQDVSIGEITDYFRQNLGPARRT*
Ga0126381_1035965331	3300010376	Tropical Forest Soil	KKVTEGTVEAVQRSTGRSEDVTIAAITEYFERILGPAPKQ*
Ga0136449_1018679881	3300010379	Peatlands Soil	KKVTEGTVEVVQRSTREMQDASIAAITEYFEKLLQSAR*
Ga0134126_104859943	3300010396	Terrestrial Soil	PFRVNVGKKVTEDRVEVVQRSTRQSHDVSIGAITDYFRQNLGAVRRT*
Ga0134124_1000283110	3300010397	Terrestrial Soil	ITVGKKVTEGTVEVVRRSTREIEDASISAISDYFEKNLRSAA*
Ga0134121_116055853	3300010401	Terrestrial Soil	EGTVEVVHRSTREMQDASIGAISEYFEKLLRPVR*
Ga0137391_106986691	3300011270	Vadose Zone Soil	INVGKKVTEDTVEVVQRSTRQSQDVRIGAITEHFKQVLGSAQE*
Ga0137388_111451881	3300012189	Vadose Zone Soil	TVGKKVTEGTVEVVRRSTRQMEDASISAISEYFEKNLRSAP*
Ga0137363_109121632	3300012202	Vadose Zone Soil	RINVGKKVTEGTVEVVQRSTRQSHDVSIGAISEYFQQILARPHS*
Ga0137399_116772692	3300012203	Vadose Zone Soil	RVTVGKKVTEDTVEVVRRSTRQIEDASIPAITEYFEKQLRSAG*
Ga0137380_107762971	3300012206	Vadose Zone Soil	KVTEDTVEVVQRSTRQSQDVSIGSIVGHFRQILGSKK*
Ga0137380_111458221	3300012206	Vadose Zone Soil	VGKKVTEGLVEVVQRSTREIQDVNIRDITSYLQNLVRPAH*
Ga0137377_119421071	3300012211	Vadose Zone Soil	KKVTEGTVEVVQRSTREMRDASISAITEYFQNLLRPAL*
Ga0150985_1098077623	3300012212	Avena Fatua Rhizosphere	VNVGKKVTEGTVEVVHRSTREMQDASIGAISEYFEKLLPPVR*
Ga0137360_101881071	3300012361	Vadose Zone Soil	NVGKKVTEDTVEVVQRSTRKSSDVSIGAVTEYFQQVLGPAGK*
Ga0137410_104900641	3300012944	Vadose Zone Soil	NVGKKVTEGTIEVVQRSTREMRDASISTITEYFEKLLRPAD*
Ga0164306_110920273	3300012988	Soil	RINVGKKVTDGAVEVVQRSTRESRDASIRDIEAHIQELLRPDR*
Ga0163162_109191353	3300013306	Switchgrass Rhizosphere	TEDRVEVVQRSTRQSQDVTIGEITEYFRQNLGPARRT*
Ga0134078_106574582	3300014157	Grasslands Soil	NVGKKVTEGTVEVVQRSTRQSQDVSIADITEYFQQLLGTGGQGQK*
Ga0182024_126588062	3300014501	Permafrost	EGTVEVVRRSTREMHDASIAAITDFFVKALKPAR*
Ga0182021_129428102	3300014502	Fen	EGTVEVVQRSTREMHDASISAITDFFAKALKPSR*
Ga0182005_12130552	3300015265	Rhizosphere	VNVGKKVTEGTVEVVQRSTREMRDVSIAAITDHFRSLLVR*
Ga0132258_101188875	3300015371	Arabidopsis Rhizosphere	FRVTVGKKVTEGTVEVVHRSTREIHDASIAAIADYFEPLLRSAR*
Ga0132257_1003142481	3300015373	Arabidopsis Rhizosphere	KKVTEGTVEVVQRSTREMRDASISAITEYFEKLLRPAS*
Ga0182037_102369611	3300016404	Soil	KKVTEGTVEVVQRSTREMRDVSIGAINEYLTRLLRPAR
Ga0187814_103660551	3300017932	Freshwater Sediment	KKVTEGTVEVVQRSTRQVQDASIAAIADYFKALRPAH
Ga0187817_101193323	3300017955	Freshwater Sediment	RVTVGKKVTEGTVEVVQRSTHQVQDVSIGAIADHFKVLMPAR
Ga0187784_113495832	3300018062	Tropical Peatland	GKKVTKDTVEVVQRSTRQMQDASIAAIAEFFQFLQPAR
Ga0210403_110494071	3300020580	Soil	FRVTVGKKVTEGTVEVVQRSTRQVQDASIGAIAEHFKALRPAP
Ga0210404_106377291	3300021088	Soil	GKKVTEGTIEVVQRSTREIRDASIAAITEYFVNLLRPVD
Ga0210400_113593432	3300021170	Soil	KVTEGTVEVVRRSTREMQDASIAAITDYFQKVLRPVP
Ga0210385_115380952	3300021402	Soil	TVGKKVTEGTVEVVQRSTREVQDASIAAITDYFKAKRPAR
Ga0210397_108016922	3300021403	Soil	VGKKVTEGTVEVVRRSTREMQDASIAAITDYFKVLRAAR
Ga0210386_104921501	3300021406	Soil	VGKKVTEGTVEVVQRSTREMQDASIASITEYFEQRLRPAH
Ga0210398_114933891	3300021477	Soil	GKKVTEGTVEVVRRSTREVQDASIATITDYFKALRTAR
Ga0212123_109102441	3300022557	Iron-Sulfur Acid Spring	IPYRVNVGKKVTEGTVEVVQRSTHEMHDASIAAITDYFKALRPAR
Ga0242657_10801661	3300022722	Soil	TVGKKVTEGTVEVVQRSTREMHDASIAGITDYFKALRPAR
Ga0242665_102479891	3300022724	Soil	KKVTEGTVEVVRRSTREMQDASIAAITDYFQKVLRPVP
Ga0242654_103628792	3300022726	Soil	VTEGTVEVVERSTRVVQDASIGAVAEHFKALQPAR
Ga0208220_11012993	3300025627	Arctic Peat Soil	VTEGTVEVVLRSTRQIQDASIGAITEYFQKNLRSAH
Ga0207699_103694823	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	KKVTEDRVEVVQRSTRQSQDVSIAAITDYFRQNLGPARRT
Ga0207645_100133125	3300025907	Miscanthus Rhizosphere	FRINVGKKVTEGTVEVVQRSTRQMQDASISAITDYFGKNLRSAR
Ga0207695_103678113	3300025913	Corn Rhizosphere	VGKKVTEGTVEVVHRSTREIHDASIAAIADYFEPLLRPAR
Ga0207693_100141946	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	KKVTEGTVEVVQRSTRQMHDASIGAITEYFRNFLPAR
Ga0207693_100162846	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	KKVTEGTVEVVQRSTRQMHDASIGAITEYFRNLLPAR
Ga0207693_113361411	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	TVGKKVTEGTVEVVRRSTRQIEDASIAAITQYFEKNLRSAA
Ga0207646_100573601	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	RVNVGKKVTEGTVEVVRRSTREMQDASIAAITDYFETVLSPRASGPHS
Ga0207650_111623822	3300025925	Switchgrass Rhizosphere	INVGKKVTEGTVEVVQRSTRQMQDASISAITDYFGKNLRSAR
Ga0207700_104895263	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	FRVNVGKKVTEGTVEVVQRSTREMRDASISAITEYFQNLLRPAL
Ga0207700_108441711	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	GKKVTEDRVEVVQRSTRQSQDVTIGEITEYFRQNLGPARRT
Ga0207664_114531351	3300025929	Agricultural Soil	VGKKVTEGTVEVVHRSTRDMRDASIATIGEYFDQLLRPAR
Ga0207698_111716191	3300026142	Corn Rhizosphere	GKKVTEGTVEVVHRSTREMQDASIGAISEYFEKLLRPVR
Ga0209267_11500213	3300026331	Soil	FRVTVGKKVTEGTIEIVQRSTREVHDASIDAVTDYFQKLFRPAR
Ga0209773_100504343	3300027829	Bog Forest Soil	VGKKVTEGTVEVVQRSTRQVQDASIAAIAEHFKALLAARG
Ga0209465_100813473	3300027874	Tropical Forest Soil	FRVTVGKKVTEGTVEVVQRSTREIEDASIASIGSYFEKRVRPAG
Ga0209283_100992631	3300027875	Vadose Zone Soil	RVNVGKKVTEGTVEVVRRSTREMQDASIAAITDYFETVLKPAR
Ga0268264_101643621	3300028381	Switchgrass Rhizosphere	TVGKKVTEGTVEVVHRSTREIHDASIAAIADYFEPLLRPGR
Ga0311363_100941534	3300029922	Fen	PFRVNVGKKVTEGTVEIIQRSTRAMQDASIPAITEYFQQILRPVQ
Ga0311333_106730591	3300030114	Fen	VTVGKKVTEGTVEVVQRSTREIHDASIATITEYFQRLLRPVR
Ga0310039_100780801	3300030706	Peatlands Soil	VTVGKKVTEGTVEVVRRSTREMQDASISAITDYFKALRPAR
Ga0265760_101155011	3300031090	Soil	VGKKVTEGTVEVVNRSTREMQDASIAAITEYFKPILKAAR
Ga0170823_106502971	3300031128	Forest Soil	KKVTEGTVEVVRRSTRESTDASIGAIAEYINQMLGPAQPRK
Ga0170824_1108006751	3300031231	Forest Soil	TEGTVEVVRRSTRESTDASIGAIAEYINQMLGPAQPRK
Ga0310686_1011043085	3300031708	Soil	TVGKKVTEGTVEVVQRSTRQIQDASIAAITDYFKVLRPAR
Ga0307474_104295553	3300031718	Hardwood Forest Soil	PFRVTVGKKVTEGTVEIVQRSTRQVQDASIGAVAEHFKALQPAR
Ga0307474_110258572	3300031718	Hardwood Forest Soil	KKVTEGTVEVVRRSTREMQDASIAAITDYFEKVLRPVP
Ga0307475_109791691	3300031754	Hardwood Forest Soil	KVTEGTVEVVQRSTREMRDASISAITEYFQNLLRPAL
Ga0306926_105181223	3300031954	Soil	VTEGTVEVVQRSTGRSEDVTIPAITEYFERILGRARSE
Ga0335081_102947941	3300032892	Soil	VTVGKKVTEGTVEIVQRSTRQMQDVSIGAIADYFKALRPAH
Ga0310810_100064501	3300033412	Soil	VGKKVTEGTVELLDRSTRKIADASITAILEQLTQLLRPA